F112177

General Info

Members Datasets Scaffolds Average Seq Length
121 96 82 285

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606306|2808629124
Length 304
Sequence VGEIPGLGEGANGCRAPRLVGMPEYIDAHGIAIVYDVHPAAGEPRGVVQLLHGVGEHAGRYAALVEALTGDGYTVYADDHRGHGRTGMKQHGGDASKLGTLGPGGMPATLAAVWQLTQLIRSKNPGLPLVLLGHSWGSFLAQMLLDEHPDAYDALVLSGSALRWPGSLNSGDLNAPWKAATASGTEWLSSDLAVGRAFLDDPLTTTKPLLQLFGVVDTLRIIGRPRRDLGHDVPVLLMVGRDDTVGGPRSVHRLAEAYRSRSGLTDVTTLVYPDARHEIFNDVTQADARADLLAWLAPRFPTRT

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221546 Microbacterium sp. Root53 Isolate Unclassified
3 2643221553 Microbacterium sp. Root553 Isolate Unclassified
4 2643221566 Microbacterium sp. Root166 Isolate Unclassified
5 2643221575 Microbacterium sp. Root61 Isolate Unclassified
6 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
7 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
8 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
9 2773857759 Microbacterium sp. 1294 Isolate Unclassified
10 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
11 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
12 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
13 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
14 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
15 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
16 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
17 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
18 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
19 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
20 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
21 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
22 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
23 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
24 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
25 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
26 2919069694 Microbacterium sp. 1154 Isolate Unclassified
27 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
28 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
29 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
30 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
31 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
32 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
33 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
34 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
35 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
36 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
39 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
65 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
66 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
67 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
68 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
69 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
70 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
71 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
72 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
73 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
74 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
75 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
76 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
77 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
78 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
79 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
80 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
81 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
82 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
83 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
84 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
85 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
91 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
92 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
93 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
94 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
95 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
96 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.12
Metatranscriptomes 1.65
Isolates 32.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.83
Bulb 0
Endosphere 8.26
Nodule 0
Rhizoplane 16.53
Rhizosphere 34.71
Stem 0
Stem Tuber 0
Unclassified 39.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005988 3300001979 Bacteria 5085
2 rootH2_10040282 3300003320 Bacteria 5005
3 Ga0006562J51391_1041770 3300003578 Bacteria 14048
4 Ga0006562J51391_1041772 3300003578 Bacteria 9460
5 Ga0070668_100448216 3300005347 Bacteria 1109
6 Ga0070659_100097751 3300005366 Bacteria 2360
7 Ga0070672_100559714 3300005543 Bacteria 993
8 Ga0075365_10025268 3300006038 Bacteria 3758
9 Ga0075368_10118508 3300006042 Bacteria 1095
10 Ga0075363_100075505 3300006048 Bacteria 1836
11 Ga0075364_10011119 3300006051 Bacteria 5464
12 Ga0075367_10056505 3300006178 Bacteria 2331
13 Ga0075369_10009813 3300006186 Bacteria 3731
14 Ga0105237_10183295 3300009545 Bacteria 2094
15 Ga0157370_10083138 3300013104 Bacteria 3011
16 Ga0171462_1002 3300013250 Bacteria 1052134
17 Ga0163162_10017828 3300013306 Bacteria 6946
18 Ga0163162_10456390 3300013306 Bacteria 1410
19 Ga0157372_10037989 3300013307 Bacteria 5313
20 Ga0209646_1000014 3300025246 Bacteria 550484
21 Ga0207647_10071922 3300025904 Bacteria 2086
22 Ga0207709_10114081 3300025935 Bacteria 1812
23 Ga0207668_10435340 3300025972 Bacteria 1116
24 Ga0307405_10026532 3300031731 Bacteria 3344
25 Ga0307406_10000537 3300031901 Bacteria 21836
26 Ga0307409_100576233 3300031995 Bacteria 1109
27 Ga0307414_10374623 3300032004 Bacteria 1229
28 Ga0395898_0205975 3300037466 Bacteria 1877
29 Ga0466970_0019862 3300044765 Bacteria 3486
30 Ga0466970_0095057 3300044765 Bacteria 1620
31 Ga0466970_0199742 3300044765 Bacteria 1112
32 Ga0495650_0111029 3300046471 Bacteria 1018
33 Ga0495645_0097951 3300046543 Bacteria 2088
34 Ga0495686_0226335 3300047472 Bacteria 1061
35 Ga0496101_0469070 3300048904 Bacteria 994
36 Ga0496102_0012661 3300048905 Bacteria 7305
37 Ga0496103_0005742 3300048906 Bacteria 7413
38 Ga0496104_0168823 3300048907 Bacteria 2098
39 Ga0496105_0221720 3300048908 Bacteria 1539
40 Ga0496105_0293140 3300048908 Bacteria 1309
41 Ga0496105_0514095 3300048908 Bacteria 938
42 Ga0496109_0016591 3300048912 Bacteria 6440
43 Ga0496109_0183246 3300048912 Bacteria 1967
44 Ga0496111_0014060 3300048914 Bacteria 5460
45 Ga0496112_0121678 3300048915 Bacteria 2580
46 Ga0496113_0117327 3300048916 Bacteria 2078
47 Ga0496114_0017264 3300048917 Bacteria 5823
48 Ga0496114_0033625 3300048917 Bacteria 4226
49 Ga0496114_0037419 3300048917 Bacteria 4013
50 Ga0496114_0110251 3300048917 Bacteria 2357
51 Ga0496114_0216451 3300048917 Bacteria 1681
52 Ga0496115_0009004 3300048918 Bacteria 7404
53 Ga0496115_0174097 3300048918 Bacteria 1779
54 Ga0496115_0300682 3300048918 Bacteria 1315
55 Ga0496117_0000091 3300048920 Bacteria 203826
56 Ga0496117_0000606 3300048920 Bacteria 58662
57 Ga0496118_0013573 3300048921 Bacteria 7690
58 Ga0496119_0011744 3300048922 Bacteria 7205
59 Ga0496119_0017114 3300048922 Bacteria 5477
60 Ga0496119_0021240 3300048922 Bacteria 4699
61 Ga0496119_0187057 3300048922 Bacteria 1082
62 Ga0496120_0005152 3300048923 Bacteria 10557
63 Ga0496120_0005371 3300048923 Bacteria 10242
64 Ga0496122_0004838 3300048925 Bacteria 16409
65 Ga0496122_0013332 3300048925 Bacteria 8053
66 Ga0496122_0019198 3300048925 Bacteria 6260
67 Ga0496123_0002429 3300048926 Bacteria 23179
68 Ga0496123_0057794 3300048926 Bacteria 2522
69 Ga0496124_0006974 3300048927 Bacteria 12130
70 Ga0496125_0019922 3300048928 Bacteria 6308
71 Ga0496125_0028633 3300048928 Bacteria 5026
72 Ga0496125_0081196 3300048928 Bacteria 2478
73 Ga0496126_0010709 3300048929 Bacteria 9580
74 Ga0496126_0023797 3300048929 Bacteria 5929
75 Ga0496126_0111388 3300048929 Bacteria 2384
76 Ga0501034_0000622 3300049571 Bacteria 55475
77 Ga0501038_0073175 3300049574 Bacteria 2902
78 Ga0501070_0000324 3300049586 Bacteria 43352
79 nmdc:mga00v17_110428_c1 3300050491 Bacteria 1744
80 nmdc:mga0yw44_58126_c1 3300050492 Bacteria 2362
81 nmdc:mga06z11_177051_c1 3300050494 Bacteria 1228
82 nmdc:mga0sz30_89090_c1 3300050516 Bacteria 1341

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0226335 Ga0495686_0226335_62_799 240
2 3300048908 Ga0496105_0514095 Ga0496105_0514095_10_762 250
3 3300032004 Ga0307414_10374623 Ga0307414_103746231 274
4 iso_pu_bacteria 2906799679 2906802228 274
5 iso_pu_bacteria 2757320536 2758225790 277
6 iso_pu_bacteria 2773857758 2774379803 277
7 iso_pu_bacteria 2852632344 2852634026 277
8 iso_pu_bacteria 2904509784 2904512594 277
9 iso_pu_bacteria 2908678064 2908679165 277
10 iso_pu_bacteria 2919069694 2919069807 277
11 iso_pu_bacteria 2974294766 2974296019 277
12 iso_pu_bacteria 2974324384 2974327717 277
13 iso_pu_bacteria 2977228692 2977229365 277
14 iso_pu_bacteria 2977236895 2977238592 277
15 iso_pu_bacteria 2977264416 2977264546 277
16 iso_pu_bacteria 2984542743 2984543626 277
17 iso_pu_bacteria 8016254467 8016256211 277
18 iso_pu_bacteria 2585428157 2588107213 278
19 iso_pu_bacteria 2643221566 2643847047 278
20 iso_pu_bacteria 2643221575 2643886884 278
21 iso_pu_bacteria 2773857759 2774382052 278
22 iso_pu_bacteria 2811994872 2812324796 278
23 iso_pu_bacteria 2821268502 2821271355 278
24 iso_pu_bacteria 2870628048 2870629239 278
25 iso_pu_bacteria 2977251589 2977252199 278
26 iso_pu_bacteria 8004212874 8004213091 278
27 iso_pu_bacteria 2643221553 2643784867 279
28 iso_pu_bacteria 2808606447 2809228600 279
29 iso_pu_bacteria 2857723135 2857726970 279
30 3300048925 Ga0496122_0013332 Ga0496122_0013332_807_1652 280
31 3300048926 Ga0496123_0057794 Ga0496123_0057794_226_1071 280
32 iso_pu_bacteria 2643221546 2643754283 280
33 iso_pu_bacteria 2946080515 2946083777 280
34 iso_pu_bacteria 8004182704 8004184227 280
35 3300013250 Ga0171462_1002 Ga0171462_1002582 281
36 3300044765 Ga0466970_0095057 Ga0466970_0095057_35_883 281
37 3300048904 Ga0496101_0469070 Ga0496101_0469070_23_871 281
38 3300048908 Ga0496105_0293140 Ga0496105_0293140_71_919 281
39 3300048920 Ga0496117_0000091 Ga0496117_0000091_95216_96064 281
40 3300048922 Ga0496119_0011744 Ga0496119_0011744_3738_4586 281
41 3300048922 Ga0496119_0017114 Ga0496119_0017114_3626_4474 281
42 3300048923 Ga0496120_0005152 Ga0496120_0005152_6508_7356 281
43 3300048923 Ga0496120_0005371 Ga0496120_0005371_5822_6670 281
44 3300048925 Ga0496122_0004838 Ga0496122_0004838_13788_14636 281
45 3300048926 Ga0496123_0002429 Ga0496123_0002429_16013_16861 281
46 3300048927 Ga0496124_0006974 Ga0496124_0006974_3655_4503 281
47 3300048929 Ga0496126_0010709 Ga0496126_0010709_6783_7631 281
48 3300049586 Ga0501070_0000324 Ga0501070_0000324_17119_17967 281
49 iso_pu_bacteria 2852646457 2852647795 281
50 iso_pu_bacteria 2945968032 2945969073 281
51 3300005347 Ga0070668_100448216 Ga0070668_1004482162 282
52 3300005366 Ga0070659_100097751 Ga0070659_1000977513 282
53 3300005543 Ga0070672_100559714 Ga0070672_1005597141 282
54 3300006038 Ga0075365_10025268 Ga0075365_100252684 282
55 3300006042 Ga0075368_10118508 Ga0075368_101185081 282
56 3300006048 Ga0075363_100075505 Ga0075363_1000755052 282
57 3300006051 Ga0075364_10011119 Ga0075364_100111193 282
58 3300006178 Ga0075367_10056505 Ga0075367_100565051 282
59 3300006186 Ga0075369_10009813 Ga0075369_100098133 282
60 3300013104 Ga0157370_10083138 Ga0157370_100831381 282
61 3300013306 Ga0163162_10456390 Ga0163162_104563902 282
62 3300025904 Ga0207647_10071922 Ga0207647_100719222 282
63 3300025972 Ga0207668_10435340 Ga0207668_104353402 282
64 3300046471 Ga0495650_0111029 Ga0495650_0111029_63_926 282
65 3300048907 Ga0496104_0168823 Ga0496104_0168823_238_1089 282
66 3300048912 Ga0496109_0183246 Ga0496109_0183246_546_1397 282
67 3300048916 Ga0496113_0117327 Ga0496113_0117327_674_1525 282
68 3300048917 Ga0496114_0110251 Ga0496114_0110251_1289_2137 282
69 3300048917 Ga0496114_0216451 Ga0496114_0216451_191_1042 282
70 3300048918 Ga0496115_0300682 Ga0496115_0300682_244_1095 282
71 3300048922 Ga0496119_0021240 Ga0496119_0021240_1871_2737 282
72 3300048929 Ga0496126_0111388 Ga0496126_0111388_780_1631 282
73 3300050491 nmdc:mga00v17_110428_c1 nmdc:mga00v17_110428_c1_633_1481 282
74 3300050492 nmdc:mga0yw44_58126_c1 nmdc:mga0yw44_58126_c1_157_1008 282
75 3300050494 nmdc:mga06z11_177051_c1 nmdc:mga06z11_177051_c1_310_1161 282
76 3300050516 nmdc:mga0sz30_89090_c1 nmdc:mga0sz30_89090_c1_323_1171 282
77 3300003320 rootH2_10040282 rootH2_100402821 283
78 3300025246 Ga0209646_1000014 Ga0209646_1000014352 283
79 3300031995 Ga0307409_100576233 Ga0307409_1005762331 283
80 3300048922 Ga0496119_0187057 Ga0496119_0187057_158_1027 283
81 3300048925 Ga0496122_0019198 Ga0496122_0019198_1424_2293 283
82 3300048928 Ga0496125_0019922 Ga0496125_0019922_2222_3091 283
83 3300048928 Ga0496125_0028633 Ga0496125_0028633_3898_4752 283
84 3300049571 Ga0501034_0000622 Ga0501034_0000622_10181_11050 283
85 3300031901 Ga0307406_10000537 Ga0307406_1000053713 284
86 3300044765 Ga0466970_0019862 Ga0466970_0019862_1159_2028 284
87 3300044765 Ga0466970_0199742 Ga0466970_0199742_130_1041 284
88 3300048920 Ga0496117_0000606 Ga0496117_0000606_57543_58412 284
89 3300048921 Ga0496118_0013573 Ga0496118_0013573_5139_6005 284
90 3300048928 Ga0496125_0081196 Ga0496125_0081196_1479_2348 284
91 3300048929 Ga0496126_0023797 Ga0496126_0023797_4326_5195 284
92 iso_pu_bacteria 2904430863 2904431246 284
93 iso_pu_bacteria 2904501621 2904504640 284
94 iso_pu_bacteria 2908674828 2908674932 284
95 iso_pu_bacteria 2909074476 2909075753 284
96 iso_pu_bacteria 2919039151 2919041016 284
97 iso_pu_bacteria 2928500415 2928501900 284
98 3300048917 Ga0496114_0017264 Ga0496114_0017264_833_1696 285
99 3300048918 Ga0496115_0174097 Ga0496115_0174097_39_902 285
100 iso_pu_bacteria 2643221635 2644197728 285
101 3300031731 Ga0307405_10026532 Ga0307405_100265322 286
102 3300046543 Ga0495645_0097951 Ga0495645_0097951_18_908 286
103 3300048908 Ga0496105_0221720 Ga0496105_0221720_554_1444 286
104 3300048917 Ga0496114_0033625 Ga0496114_0033625_1246_2136 286
105 3300049574 Ga0501038_0073175 Ga0501038_0073175_1238_2104 286
106 3300003578 Ga0006562J51391_1041770 Ga0006562J51391_10417707 287
107 3300003578 Ga0006562J51391_1041772 Ga0006562J51391_10417728 287
108 3300009545 Ga0105237_10183295 Ga0105237_101832952 287
109 3300013306 Ga0163162_10017828 Ga0163162_100178283 287
110 3300013307 Ga0157372_10037989 Ga0157372_100379895 287
111 3300048905 Ga0496102_0012661 Ga0496102_0012661_300_1184 287
112 3300048906 Ga0496103_0005742 Ga0496103_0005742_5433_6317 287
113 3300048912 Ga0496109_0016591 Ga0496109_0016591_605_1489 287
114 3300048914 Ga0496111_0014060 Ga0496111_0014060_1361_2245 287
115 3300048915 Ga0496112_0121678 Ga0496112_0121678_1092_1976 287
116 3300048917 Ga0496114_0037419 Ga0496114_0037419_1516_2400 287
117 3300048918 Ga0496115_0009004 Ga0496115_0009004_1516_2400 287
118 iso_pu_bacteria 2808606306 2808629124 287
119 3300001979 JGI24740J21852_10005988 JGI24740J21852_100059882 289
120 3300025935 Ga0207709_10114081 Ga0207709_101140812 289
121 3300037466 Ga0395898_0205975 Ga0395898_0205975_679_1548 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

42

284

0.85

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

46

206

0.83

PF00326

Peptidase_S9

Prolyl oligopeptidase family

61

301

0.8

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

50

292

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jwe-assembly1.cif.gz_A crystal structure of human mono-glyceride lipase in complex with sar629 0.8456 7 286
6eic-assembly2.cif.gz_A crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.8283 4 283
6eic-assembly2.cif.gz_A crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.8138 4 283
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.8115 1 285
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.8087 1 285
ID Description Score Start End Superfamily
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8515 5 156 3.40.50.1820
af_P25641_174_392_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8187 94 146 3.40.50.1820
af_Q2FYZ3_1_302_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.813 2 284 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8041 1 285 3.40.50.1820
af_Q4CSM0_30_309_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8026 8 284 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2S9AFF2-F1-model_v4 Lysophospholipase 0.9954 5 285
AF-A0A0L6HX80-F1-model_v4 Lysophospholipase 0.995 4 288
AF-A0A7Y9QRK1-F1-model_v4 deleted 0.9896 7 289
AF-A0A0L6HX80-F1-model_v4 Lysophospholipase 0.9881 4 288
AF-A0A3D9TBD8-F1-model_v4 deleted 0.9844 7 289

Feature Viewer

pLDDT pTM Quality
95.09 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map