F111298
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 121 | 94 | 121 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0536944|Ga0451576_0536944_499_1203 |
| Length | 234 |
| Sequence | VIALLDYGSGNLRSVQKALIKAGAEVKLVQRAEEVGAAEGMVLPGVGAFDDCVNAMEKQELLEATREFIKTGRPFLGICVGYQALFERSEEFNSSAAGLGIFRGNVVRFSERVWTGSAGVPAGESRLKIPQIGWNQLEIVKPECPLYRGIADGSYVYFVHSFFPKPLEPEIVATQTEYGQCFASSVWRENVFATQFHPEKSQAVGLRLLSNFVELTNHGRASVPGFKAAPAACQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 26 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 27 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 28 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 29 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 31 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 32 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 33 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 60 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 64 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 65 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 66 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 67 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 68 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 69 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 70 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 71 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 72 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 73 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 74 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 75 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 76 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 77 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 83 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 84 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 85 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 86 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 87 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 88 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 89 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 90 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 91 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 92 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 93 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 94 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.48 |
| Nodule | 0 |
| Rhizoplane | 0.83 |
| Rhizosphere | 93.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_4932708 | 2162886011 | Unclassified | 1026 |
| 2 | Ga0065712_10126073 | 3300005290 | Bacteria | 1592 |
| 3 | Ga0065707_10268721 | 3300005295 | Unclassified | 1077 |
| 4 | Ga0070683_100510241 | 3300005329 | Bacteria | 1149 |
| 5 | Ga0068868_100021449 | 3300005338 | Bacteria | 4864 |
| 6 | Ga0068868_100584038 | 3300005338 | Bacteria | 988 |
| 7 | Ga0070689_100013928 | 3300005340 | Bacteria | 5833 |
| 8 | Ga0070689_100689237 | 3300005340 | Unclassified | 891 |
| 9 | Ga0070687_100082129 | 3300005343 | Unclassified | 1761 |
| 10 | Ga0070661_100304741 | 3300005344 | Bacteria | 1241 |
| 11 | Ga0070669_100901334 | 3300005353 | Bacteria | 755 |
| 12 | Ga0070675_100083870 | 3300005354 | Unclassified | 2661 |
| 13 | Ga0070675_100417010 | 3300005354 | Bacteria | 1200 |
| 14 | Ga0070671_100100720 | 3300005355 | Bacteria | 2424 |
| 15 | Ga0070688_100004086 | 3300005365 | Bacteria | 7571 |
| 16 | Ga0070701_10014153 | 3300005438 | Bacteria | 3650 |
| 17 | Ga0070705_100058879 | 3300005440 | Unclassified | 2272 |
| 18 | Ga0070694_100692440 | 3300005444 | Unclassified | 828 |
| 19 | Ga0070708_100290920 | 3300005445 | Bacteria | 1538 |
| 20 | Ga0070678_100572247 | 3300005456 | Bacteria | 1005 |
| 21 | Ga0070699_100019751 | 3300005518 | Bacteria | 5808 |
| 22 | Ga0070679_100392619 | 3300005530 | Bacteria | 1334 |
| 23 | Ga0070697_100524832 | 3300005536 | Bacteria | 1037 |
| 24 | Ga0070665_100128446 | 3300005548 | Bacteria | 2537 |
| 25 | Ga0070665_101145668 | 3300005548 | Bacteria | 789 |
| 26 | Ga0070704_100581365 | 3300005549 | Unclassified | 982 |
| 27 | Ga0068857_100177423 | 3300005577 | Bacteria | 1938 |
| 28 | Ga0068852_100371505 | 3300005616 | Bacteria | 1401 |
| 29 | Ga0068859_100151006 | 3300005617 | Bacteria | 2398 |
| 30 | Ga0068859_100279576 | 3300005617 | Bacteria | 1762 |
| 31 | Ga0068859_100403986 | 3300005617 | Bacteria | 1462 |
| 32 | Ga0068864_100067870 | 3300005618 | Unclassified | 3097 |
| 33 | Ga0068866_10136543 | 3300005718 | Unclassified | 1402 |
| 34 | Ga0081539_10020840 | 3300005985 | Bacteria | 4405 |
| 35 | Ga0070717_10037626 | 3300006028 | Bacteria | 3930 |
| 36 | Ga0075428_100045699 | 3300006844 | Bacteria | 4811 |
| 37 | Ga0075433_10619540 | 3300006852 | Unclassified | 949 |
| 38 | Ga0075436_100137954 | 3300006914 | Bacteria | 1713 |
| 39 | Ga0097620_100151014 | 3300006931 | Bacteria | 2398 |
| 40 | Ga0097620_100279574 | 3300006931 | Bacteria | 1762 |
| 41 | Ga0097620_100403950 | 3300006931 | Bacteria | 1462 |
| 42 | Ga0075435_100910046 | 3300007076 | Bacteria | 767 |
| 43 | Ga0105240_10730499 | 3300009093 | Bacteria | 1078 |
| 44 | Ga0111539_10002895 | 3300009094 | Bacteria | 22794 |
| 45 | Ga0111539_11197536 | 3300009094 | Unclassified | 882 |
| 46 | Ga0105241_10721455 | 3300009174 | Bacteria | 912 |
| 47 | Ga0105248_10013752 | 3300009177 | Bacteria | 8909 |
| 48 | Ga0105238_10452188 | 3300009551 | Bacteria | 1281 |
| 49 | Ga0105238_10554008 | 3300009551 | Bacteria | 1154 |
| 50 | Ga0105239_10014084 | 3300010375 | Bacteria | 8878 |
| 51 | Ga0105239_10223868 | 3300010375 | Bacteria | 2110 |
| 52 | Ga0157371_10364561 | 3300013102 | Bacteria | 1053 |
| 53 | Ga0157374_10257323 | 3300013296 | Bacteria | 1719 |
| 54 | Ga0157378_10032510 | 3300013297 | Bacteria | 4609 |
| 55 | Ga0163162_10000646 | 3300013306 | Bacteria | 32306 |
| 56 | Ga0157375_10071478 | 3300013308 | Bacteria | 3483 |
| 57 | Ga0163163_10004586 | 3300014325 | Bacteria | 11799 |
| 58 | Ga0163163_10023922 | 3300014325 | Bacteria | 5808 |
| 59 | Ga0157379_10177826 | 3300014968 | Bacteria | 1922 |
| 60 | Ga0157376_10029698 | 3300014969 | Unclassified | 4357 |
| 61 | Ga0207686_10145509 | 3300025934 | Bacteria | 1643 |
| 62 | Ga0207670_10024406 | 3300025936 | Bacteria | 3778 |
| 63 | Ga0207670_10025228 | 3300025936 | Bacteria | 3728 |
| 64 | Ga0207670_10113438 | 3300025936 | Bacteria | 1958 |
| 65 | Ga0207711_10084194 | 3300025941 | Bacteria | 2783 |
| 66 | Ga0207661_10430671 | 3300025944 | Bacteria | 1199 |
| 67 | Ga0207651_10370345 | 3300025960 | Bacteria | 1212 |
| 68 | Ga0207677_10299197 | 3300026023 | Bacteria | 1328 |
| 69 | Ga0207648_10269186 | 3300026089 | Unclassified | 1522 |
| 70 | Ga0207676_10288710 | 3300026095 | Bacteria | 1492 |
| 71 | Ga0207674_10210047 | 3300026116 | Bacteria | 1896 |
| 72 | Ga0207683_10204094 | 3300026121 | Bacteria | 1797 |
| 73 | Ga0207428_10023732 | 3300027907 | Bacteria | 5152 |
| 74 | Ga0268266_10501290 | 3300028379 | Bacteria | 1159 |
| 75 | Ga0268265_10312260 | 3300028380 | Bacteria | 1420 |
| 76 | Ga0268264_10129390 | 3300028381 | Bacteria | 2236 |
| 77 | Ga0265338_10000312 | 3300028800 | Bacteria | 87999 |
| 78 | Ga0265338_10000660 | 3300028800 | Bacteria | 59683 |
| 79 | Ga0265338_10023221 | 3300028800 | Bacteria | 6385 |
| 80 | Ga0265338_10254099 | 3300028800 | Bacteria | 1295 |
| 81 | Ga0265332_10090677 | 3300031238 | Unclassified | 1293 |
| 82 | Ga0265329_10001850 | 3300031242 | Bacteria | 10014 |
| 83 | Ga0307508_10067131 | 3300031616 | Bacteria | 3156 |
| 84 | Ga0265314_10000284 | 3300031711 | Bacteria | 73660 |
| 85 | Ga0373956_0167167 | 3300035119 | Bacteria | 1038 |
| 86 | Ga0373937_0264709 | 3300036401 | Bacteria | 1622 |
| 87 | Ga0395905_0126732 | 3300037471 | Bacteria | 2401 |
| 88 | Ga0400484_37844 | 3300038725 | Bacteria | 3167 |
| 89 | Ga0400490_20932 | 3300038726 | Bacteria | 2535 |
| 90 | Ga0400487_40022 | 3300039110 | Bacteria | 5179 |
| 91 | Ga0451577_0001251 | 3300042876 | Bacteria | 35154 |
| 92 | Ga0451577_0139866 | 3300042876 | Bacteria | 2175 |
| 93 | Ga0451577_0178219 | 3300042876 | Bacteria | 1916 |
| 94 | Ga0451577_0570301 | 3300042876 | Bacteria | 1027 |
| 95 | Ga0453684_0000254 | 3300044712 | Bacteria | 229888 |
| 96 | Ga0453684_0031689 | 3300044712 | Bacteria | 7422 |
| 97 | Ga0453684_0117301 | 3300044712 | Bacteria | 3222 |
| 98 | Ga0453684_0498223 | 3300044712 | Bacteria | 1349 |
| 99 | Ga0453684_0708544 | 3300044712 | Bacteria | 1093 |
| 100 | Ga0451576_0000453 | 3300045051 | Bacteria | 93077 |
| 101 | Ga0451576_0154328 | 3300045051 | Unclassified | 2395 |
| 102 | Ga0451576_0536944 | 3300045051 | Bacteria | 1229 |
| 103 | Ga0451576_0951833 | 3300045051 | Bacteria | 900 |
| 104 | Ga0495630_0300320 | 3300046517 | Bacteria | 1227 |
| 105 | Ga0495645_0025361 | 3300046543 | Bacteria | 4302 |
| 106 | Ga0495599_0319309 | 3300046678 | Bacteria | 935 |
| 107 | Ga0495658_0038747 | 3300046683 | Bacteria | 2640 |
| 108 | Ga0495675_0168552 | 3300047444 | Bacteria | 1346 |
| 109 | Ga0496105_0761548 | 3300048908 | Bacteria | 739 |
| 110 | Ga0501033_0021820 | 3300049570 | Bacteria | 4832 |
| 111 | Ga0501047_0001549 | 3300049581 | Bacteria | 22497 |
| 112 | Ga0501067_0012775 | 3300049583 | Bacteria | 4652 |
| 113 | Ga0501072_0007477 | 3300049588 | Bacteria | 8290 |
| 114 | Ga0501073_0062228 | 3300049589 | Bacteria | 2603 |
| 115 | Ga0501080_0084250 | 3300049742 | Bacteria | 2953 |
| 116 | Ga0501278_000650 | 3300049774 | Bacteria | 2649 |
| 117 | Ga0501044_0255296 | 3300049823 | Bacteria | 1693 |
| 118 | nmdc:mga0n895_846940_c1 | 3300050512 | Bacteria | 902 |
| 119 | Ga0500559_0261747 | 3300053136 | Bacteria | 814 |
| 120 | Ga0500636_0045484 | 3300053177 | Bacteria | 2589 |
| 121 | Ga0500645_038611 | 3300053730 | Bacteria | 1416 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025934 | Ga0207686_10145509 | Ga0207686_101455093 | 181 |
| 2 | 3300045051 | Ga0451576_0951833 | Ga0451576_0951833_20_598 | 187 |
| 3 | 3300009094 | Ga0111539_11197536 | Ga0111539_111975361 | 189 |
| 4 | 3300049774 | Ga0501278_000650 | Ga0501278_000650_437_1015 | 190 |
| 5 | 3300005329 | Ga0070683_100510241 | Ga0070683_1005102412 | 192 |
| 6 | 3300025944 | Ga0207661_10430671 | Ga0207661_104306712 | 192 |
| 7 | 3300013102 | Ga0157371_10364561 | Ga0157371_103645611 | 194 |
| 8 | 3300028800 | Ga0265338_10023221 | Ga0265338_100232213 | 194 |
| 9 | 3300037471 | Ga0395905_0126732 | Ga0395905_0126732_205_804 | 196 |
| 10 | 3300031238 | Ga0265332_10090677 | Ga0265332_100906772 | 198 |
| 11 | 3300031616 | Ga0307508_10067131 | Ga0307508_100671314 | 198 |
| 12 | 3300009094 | Ga0111539_10002895 | Ga0111539_1000289520 | 200 |
| 13 | 3300027907 | Ga0207428_10023732 | Ga0207428_100237322 | 200 |
| 14 | 3300031242 | Ga0265329_10001850 | Ga0265329_100018502 | 200 |
| 15 | 3300031711 | Ga0265314_10000284 | Ga0265314_1000028434 | 200 |
| 16 | 3300035119 | Ga0373956_0167167 | Ga0373956_0167167_288_911 | 200 |
| 17 | 3300042876 | Ga0451577_0001251 | Ga0451577_0001251_28802_29425 | 200 |
| 18 | 3300042876 | Ga0451577_0570301 | Ga0451577_0570301_277_900 | 200 |
| 19 | 3300044712 | Ga0453684_0000254 | Ga0453684_0000254_141470_142093 | 200 |
| 20 | 3300044712 | Ga0453684_0708544 | Ga0453684_0708544_76_699 | 200 |
| 21 | 3300005295 | Ga0065707_10268721 | Ga0065707_102687212 | 201 |
| 22 | 3300005340 | Ga0070689_100013928 | Ga0070689_1000139282 | 201 |
| 23 | 3300005343 | Ga0070687_100082129 | Ga0070687_1000821293 | 201 |
| 24 | 3300005354 | Ga0070675_100417010 | Ga0070675_1004170102 | 201 |
| 25 | 3300005365 | Ga0070688_100004086 | Ga0070688_1000040866 | 201 |
| 26 | 3300005438 | Ga0070701_10014153 | Ga0070701_100141533 | 201 |
| 27 | 3300005440 | Ga0070705_100058879 | Ga0070705_1000588793 | 201 |
| 28 | 3300005549 | Ga0070704_100581365 | Ga0070704_1005813652 | 201 |
| 29 | 3300005577 | Ga0068857_100177423 | Ga0068857_1001774232 | 201 |
| 30 | 3300005617 | Ga0068859_100279576 | Ga0068859_1002795761 | 201 |
| 31 | 3300005985 | Ga0081539_10020840 | Ga0081539_100208401 | 201 |
| 32 | 3300006028 | Ga0070717_10037626 | Ga0070717_100376263 | 201 |
| 33 | 3300006844 | Ga0075428_100045699 | Ga0075428_1000456994 | 201 |
| 34 | 3300006852 | Ga0075433_10619540 | Ga0075433_106195402 | 201 |
| 35 | 3300006931 | Ga0097620_100279574 | Ga0097620_1002795741 | 201 |
| 36 | 3300007076 | Ga0075435_100910046 | Ga0075435_1009100461 | 201 |
| 37 | 3300009093 | Ga0105240_10730499 | Ga0105240_107304991 | 201 |
| 38 | 3300009551 | Ga0105238_10452188 | Ga0105238_104521882 | 201 |
| 39 | 3300025936 | Ga0207670_10024406 | Ga0207670_100244063 | 201 |
| 40 | 3300025936 | Ga0207670_10025228 | Ga0207670_100252282 | 201 |
| 41 | 3300026116 | Ga0207674_10210047 | Ga0207674_102100472 | 201 |
| 42 | 3300028800 | Ga0265338_10000312 | Ga0265338_1000031229 | 201 |
| 43 | 3300028800 | Ga0265338_10000660 | Ga0265338_1000066038 | 201 |
| 44 | 3300042876 | Ga0451577_0139866 | Ga0451577_0139866_136_771 | 201 |
| 45 | 3300042876 | Ga0451577_0178219 | Ga0451577_0178219_352_978 | 201 |
| 46 | 3300044712 | Ga0453684_0031689 | Ga0453684_0031689_5068_5703 | 201 |
| 47 | 3300044712 | Ga0453684_0117301 | Ga0453684_0117301_1411_2073 | 201 |
| 48 | 3300045051 | Ga0451576_0000453 | Ga0451576_0000453_5618_6244 | 201 |
| 49 | 3300045051 | Ga0451576_0154328 | Ga0451576_0154328_930_1547 | 201 |
| 50 | 3300045051 | Ga0451576_0536944 | Ga0451576_0536944_499_1203 | 201 |
| 51 | 3300046517 | Ga0495630_0300320 | Ga0495630_0300320_539_1159 | 201 |
| 52 | 3300046683 | Ga0495658_0038747 | Ga0495658_0038747_1526_2143 | 201 |
| 53 | 3300048908 | Ga0496105_0761548 | Ga0496105_0761548_54_665 | 201 |
| 54 | 3300050512 | nmdc:mga0n895_846940_c1 | nmdc:mga0n895_846940_c1_92_703 | 201 |
| 55 | 3300038725 | Ga0400484_37844 | Ga0400484_37844_38_706 | 202 |
| 56 | 2162886011 | MRS1b_contig_4932708 | MRS1b_0967.00003250 | 203 |
| 57 | 3300005290 | Ga0065712_10126073 | Ga0065712_101260732 | 203 |
| 58 | 3300005338 | Ga0068868_100021449 | Ga0068868_1000214497 | 203 |
| 59 | 3300005338 | Ga0068868_100584038 | Ga0068868_1005840382 | 203 |
| 60 | 3300005340 | Ga0070689_100689237 | Ga0070689_1006892371 | 203 |
| 61 | 3300005344 | Ga0070661_100304741 | Ga0070661_1003047412 | 203 |
| 62 | 3300005353 | Ga0070669_100901334 | Ga0070669_1009013341 | 203 |
| 63 | 3300005354 | Ga0070675_100083870 | Ga0070675_1000838703 | 203 |
| 64 | 3300005355 | Ga0070671_100100720 | Ga0070671_1001007203 | 203 |
| 65 | 3300005444 | Ga0070694_100692440 | Ga0070694_1006924402 | 203 |
| 66 | 3300005445 | Ga0070708_100290920 | Ga0070708_1002909202 | 203 |
| 67 | 3300005456 | Ga0070678_100572247 | Ga0070678_1005722472 | 203 |
| 68 | 3300005518 | Ga0070699_100019751 | Ga0070699_1000197514 | 203 |
| 69 | 3300005530 | Ga0070679_100392619 | Ga0070679_1003926191 | 203 |
| 70 | 3300005536 | Ga0070697_100524832 | Ga0070697_1005248322 | 203 |
| 71 | 3300005548 | Ga0070665_100128446 | Ga0070665_1001284463 | 203 |
| 72 | 3300005548 | Ga0070665_101145668 | Ga0070665_1011456682 | 203 |
| 73 | 3300005616 | Ga0068852_100371505 | Ga0068852_1003715052 | 203 |
| 74 | 3300005617 | Ga0068859_100151006 | Ga0068859_1001510062 | 203 |
| 75 | 3300005617 | Ga0068859_100403986 | Ga0068859_1004039862 | 203 |
| 76 | 3300005618 | Ga0068864_100067870 | Ga0068864_1000678704 | 203 |
| 77 | 3300005718 | Ga0068866_10136543 | Ga0068866_101365432 | 203 |
| 78 | 3300006914 | Ga0075436_100137954 | Ga0075436_1001379542 | 203 |
| 79 | 3300006931 | Ga0097620_100151014 | Ga0097620_1001510142 | 203 |
| 80 | 3300006931 | Ga0097620_100403950 | Ga0097620_1004039502 | 203 |
| 81 | 3300009174 | Ga0105241_10721455 | Ga0105241_107214552 | 203 |
| 82 | 3300009177 | Ga0105248_10013752 | Ga0105248_1001375210 | 203 |
| 83 | 3300009551 | Ga0105238_10554008 | Ga0105238_105540082 | 203 |
| 84 | 3300010375 | Ga0105239_10014084 | Ga0105239_100140847 | 203 |
| 85 | 3300010375 | Ga0105239_10223868 | Ga0105239_102238683 | 203 |
| 86 | 3300013296 | Ga0157374_10257323 | Ga0157374_102573232 | 203 |
| 87 | 3300013297 | Ga0157378_10032510 | Ga0157378_100325103 | 203 |
| 88 | 3300013306 | Ga0163162_10000646 | Ga0163162_1000064611 | 203 |
| 89 | 3300013308 | Ga0157375_10071478 | Ga0157375_100714784 | 203 |
| 90 | 3300014325 | Ga0163163_10004586 | Ga0163163_100045864 | 203 |
| 91 | 3300014325 | Ga0163163_10023922 | Ga0163163_100239228 | 203 |
| 92 | 3300014968 | Ga0157379_10177826 | Ga0157379_101778262 | 203 |
| 93 | 3300014969 | Ga0157376_10029698 | Ga0157376_100296981 | 203 |
| 94 | 3300025936 | Ga0207670_10113438 | Ga0207670_101134382 | 203 |
| 95 | 3300025941 | Ga0207711_10084194 | Ga0207711_100841944 | 203 |
| 96 | 3300025960 | Ga0207651_10370345 | Ga0207651_103703451 | 203 |
| 97 | 3300026023 | Ga0207677_10299197 | Ga0207677_102991972 | 203 |
| 98 | 3300026089 | Ga0207648_10269186 | Ga0207648_102691861 | 203 |
| 99 | 3300026095 | Ga0207676_10288710 | Ga0207676_102887102 | 203 |
| 100 | 3300026121 | Ga0207683_10204094 | Ga0207683_102040942 | 203 |
| 101 | 3300028379 | Ga0268266_10501290 | Ga0268266_105012902 | 203 |
| 102 | 3300028380 | Ga0268265_10312260 | Ga0268265_103122602 | 203 |
| 103 | 3300028381 | Ga0268264_10129390 | Ga0268264_101293903 | 203 |
| 104 | 3300028800 | Ga0265338_10254099 | Ga0265338_102540993 | 203 |
| 105 | 3300036401 | Ga0373937_0264709 | Ga0373937_0264709_665_1294 | 203 |
| 106 | 3300038726 | Ga0400490_20932 | Ga0400490_20932_874_1515 | 203 |
| 107 | 3300039110 | Ga0400487_40022 | Ga0400487_40022_2696_3337 | 203 |
| 108 | 3300044712 | Ga0453684_0498223 | Ga0453684_0498223_603_1277 | 203 |
| 109 | 3300046543 | Ga0495645_0025361 | Ga0495645_0025361_249_878 | 203 |
| 110 | 3300046678 | Ga0495599_0319309 | Ga0495599_0319309_117_746 | 203 |
| 111 | 3300047444 | Ga0495675_0168552 | Ga0495675_0168552_249_878 | 203 |
| 112 | 3300049570 | Ga0501033_0021820 | Ga0501033_0021820_2749_3402 | 203 |
| 113 | 3300049581 | Ga0501047_0001549 | Ga0501047_0001549_15210_15854 | 203 |
| 114 | 3300049583 | Ga0501067_0012775 | Ga0501067_0012775_3661_4305 | 203 |
| 115 | 3300049588 | Ga0501072_0007477 | Ga0501072_0007477_3530_4174 | 203 |
| 116 | 3300049589 | Ga0501073_0062228 | Ga0501073_0062228_1070_1714 | 203 |
| 117 | 3300049742 | Ga0501080_0084250 | Ga0501080_0084250_1962_2606 | 203 |
| 118 | 3300049823 | Ga0501044_0255296 | Ga0501044_0255296_346_999 | 203 |
| 119 | 3300053136 | Ga0500559_0261747 | Ga0500559_0261747_109_753 | 203 |
| 120 | 3300053177 | Ga0500636_0045484 | Ga0500636_0045484_1197_1841 | 203 |
| 121 | 3300053730 | Ga0500645_038611 | Ga0500645_038611_13_663 | 203 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gud-assembly2.cif.gz_B | crystal structure of amidotransferase hish from vibrio cholerae | 0.9453 | 1 | 198 |
| 4gud-assembly1.cif.gz_A | crystal structure of amidotransferase hish from vibrio cholerae | 0.9439 | 3 | 198 |
| 1ka9-assembly1.cif.gz_H | imidazole glycerol phosphate synthase | 0.9332 | 4 | 198 |
| 4gud-assembly1.cif.gz_A | crystal structure of amidotransferase hish from vibrio cholerae | 0.9208 | 3 | 198 |
| 4gud-assembly2.cif.gz_B | crystal structure of amidotransferase hish from vibrio cholerae | 0.909 | 1 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57929_1_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9764 | 4 | 199 | 3.40.50.880 |
| af_Q57929_1_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9568 | 4 | 199 | 3.40.50.880 |
| 4gudA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9401 | 3 | 198 | 3.40.50.880 |
| 1ka9H00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9332 | 4 | 198 | 3.40.50.880 |
| af_P9WMM1_1_205_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9326 | 1 | 199 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8NKX7-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9951 | 2 | 203 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
| AF-A0A2V8Q433-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9933 | 1 | 199 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
| AF-A0A3B9LQV5-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9924 | 5 | 199 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
| AF-A0A845CHY9-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH | 0.9915 | 44 | 198 |
GO:0000105
GO:0000107 GO:0006541 GO:0016787 GO:0016829 |
| AF-A0A101G9J7-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9896 | 4 | 199 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar