F111298

General Info

Members Datasets Scaffolds Average Seq Length
121 94 121 207

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0536944|Ga0451576_0536944_499_1203
Length 234
Sequence VIALLDYGSGNLRSVQKALIKAGAEVKLVQRAEEVGAAEGMVLPGVGAFDDCVNAMEKQELLEATREFIKTGRPFLGICVGYQALFERSEEFNSSAAGLGIFRGNVVRFSERVWTGSAGVPAGESRLKIPQIGWNQLEIVKPECPLYRGIADGSYVYFVHSFFPKPLEPEIVATQTEYGQCFASSVWRENVFATQFHPEKSQAVGLRLLSNFVELTNHGRASVPGFKAAPAACQ

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
65 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
72 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
73 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
79 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
86 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
87 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
92 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
93 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
94 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0
Rhizoplane 0.83
Rhizosphere 93.39
Stem 0
Stem Tuber 0
Unclassified 3.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4932708 2162886011 Unclassified 1026
2 Ga0065712_10126073 3300005290 Bacteria 1592
3 Ga0065707_10268721 3300005295 Unclassified 1077
4 Ga0070683_100510241 3300005329 Bacteria 1149
5 Ga0068868_100021449 3300005338 Bacteria 4864
6 Ga0068868_100584038 3300005338 Bacteria 988
7 Ga0070689_100013928 3300005340 Bacteria 5833
8 Ga0070689_100689237 3300005340 Unclassified 891
9 Ga0070687_100082129 3300005343 Unclassified 1761
10 Ga0070661_100304741 3300005344 Bacteria 1241
11 Ga0070669_100901334 3300005353 Bacteria 755
12 Ga0070675_100083870 3300005354 Unclassified 2661
13 Ga0070675_100417010 3300005354 Bacteria 1200
14 Ga0070671_100100720 3300005355 Bacteria 2424
15 Ga0070688_100004086 3300005365 Bacteria 7571
16 Ga0070701_10014153 3300005438 Bacteria 3650
17 Ga0070705_100058879 3300005440 Unclassified 2272
18 Ga0070694_100692440 3300005444 Unclassified 828
19 Ga0070708_100290920 3300005445 Bacteria 1538
20 Ga0070678_100572247 3300005456 Bacteria 1005
21 Ga0070699_100019751 3300005518 Bacteria 5808
22 Ga0070679_100392619 3300005530 Bacteria 1334
23 Ga0070697_100524832 3300005536 Bacteria 1037
24 Ga0070665_100128446 3300005548 Bacteria 2537
25 Ga0070665_101145668 3300005548 Bacteria 789
26 Ga0070704_100581365 3300005549 Unclassified 982
27 Ga0068857_100177423 3300005577 Bacteria 1938
28 Ga0068852_100371505 3300005616 Bacteria 1401
29 Ga0068859_100151006 3300005617 Bacteria 2398
30 Ga0068859_100279576 3300005617 Bacteria 1762
31 Ga0068859_100403986 3300005617 Bacteria 1462
32 Ga0068864_100067870 3300005618 Unclassified 3097
33 Ga0068866_10136543 3300005718 Unclassified 1402
34 Ga0081539_10020840 3300005985 Bacteria 4405
35 Ga0070717_10037626 3300006028 Bacteria 3930
36 Ga0075428_100045699 3300006844 Bacteria 4811
37 Ga0075433_10619540 3300006852 Unclassified 949
38 Ga0075436_100137954 3300006914 Bacteria 1713
39 Ga0097620_100151014 3300006931 Bacteria 2398
40 Ga0097620_100279574 3300006931 Bacteria 1762
41 Ga0097620_100403950 3300006931 Bacteria 1462
42 Ga0075435_100910046 3300007076 Bacteria 767
43 Ga0105240_10730499 3300009093 Bacteria 1078
44 Ga0111539_10002895 3300009094 Bacteria 22794
45 Ga0111539_11197536 3300009094 Unclassified 882
46 Ga0105241_10721455 3300009174 Bacteria 912
47 Ga0105248_10013752 3300009177 Bacteria 8909
48 Ga0105238_10452188 3300009551 Bacteria 1281
49 Ga0105238_10554008 3300009551 Bacteria 1154
50 Ga0105239_10014084 3300010375 Bacteria 8878
51 Ga0105239_10223868 3300010375 Bacteria 2110
52 Ga0157371_10364561 3300013102 Bacteria 1053
53 Ga0157374_10257323 3300013296 Bacteria 1719
54 Ga0157378_10032510 3300013297 Bacteria 4609
55 Ga0163162_10000646 3300013306 Bacteria 32306
56 Ga0157375_10071478 3300013308 Bacteria 3483
57 Ga0163163_10004586 3300014325 Bacteria 11799
58 Ga0163163_10023922 3300014325 Bacteria 5808
59 Ga0157379_10177826 3300014968 Bacteria 1922
60 Ga0157376_10029698 3300014969 Unclassified 4357
61 Ga0207686_10145509 3300025934 Bacteria 1643
62 Ga0207670_10024406 3300025936 Bacteria 3778
63 Ga0207670_10025228 3300025936 Bacteria 3728
64 Ga0207670_10113438 3300025936 Bacteria 1958
65 Ga0207711_10084194 3300025941 Bacteria 2783
66 Ga0207661_10430671 3300025944 Bacteria 1199
67 Ga0207651_10370345 3300025960 Bacteria 1212
68 Ga0207677_10299197 3300026023 Bacteria 1328
69 Ga0207648_10269186 3300026089 Unclassified 1522
70 Ga0207676_10288710 3300026095 Bacteria 1492
71 Ga0207674_10210047 3300026116 Bacteria 1896
72 Ga0207683_10204094 3300026121 Bacteria 1797
73 Ga0207428_10023732 3300027907 Bacteria 5152
74 Ga0268266_10501290 3300028379 Bacteria 1159
75 Ga0268265_10312260 3300028380 Bacteria 1420
76 Ga0268264_10129390 3300028381 Bacteria 2236
77 Ga0265338_10000312 3300028800 Bacteria 87999
78 Ga0265338_10000660 3300028800 Bacteria 59683
79 Ga0265338_10023221 3300028800 Bacteria 6385
80 Ga0265338_10254099 3300028800 Bacteria 1295
81 Ga0265332_10090677 3300031238 Unclassified 1293
82 Ga0265329_10001850 3300031242 Bacteria 10014
83 Ga0307508_10067131 3300031616 Bacteria 3156
84 Ga0265314_10000284 3300031711 Bacteria 73660
85 Ga0373956_0167167 3300035119 Bacteria 1038
86 Ga0373937_0264709 3300036401 Bacteria 1622
87 Ga0395905_0126732 3300037471 Bacteria 2401
88 Ga0400484_37844 3300038725 Bacteria 3167
89 Ga0400490_20932 3300038726 Bacteria 2535
90 Ga0400487_40022 3300039110 Bacteria 5179
91 Ga0451577_0001251 3300042876 Bacteria 35154
92 Ga0451577_0139866 3300042876 Bacteria 2175
93 Ga0451577_0178219 3300042876 Bacteria 1916
94 Ga0451577_0570301 3300042876 Bacteria 1027
95 Ga0453684_0000254 3300044712 Bacteria 229888
96 Ga0453684_0031689 3300044712 Bacteria 7422
97 Ga0453684_0117301 3300044712 Bacteria 3222
98 Ga0453684_0498223 3300044712 Bacteria 1349
99 Ga0453684_0708544 3300044712 Bacteria 1093
100 Ga0451576_0000453 3300045051 Bacteria 93077
101 Ga0451576_0154328 3300045051 Unclassified 2395
102 Ga0451576_0536944 3300045051 Bacteria 1229
103 Ga0451576_0951833 3300045051 Bacteria 900
104 Ga0495630_0300320 3300046517 Bacteria 1227
105 Ga0495645_0025361 3300046543 Bacteria 4302
106 Ga0495599_0319309 3300046678 Bacteria 935
107 Ga0495658_0038747 3300046683 Bacteria 2640
108 Ga0495675_0168552 3300047444 Bacteria 1346
109 Ga0496105_0761548 3300048908 Bacteria 739
110 Ga0501033_0021820 3300049570 Bacteria 4832
111 Ga0501047_0001549 3300049581 Bacteria 22497
112 Ga0501067_0012775 3300049583 Bacteria 4652
113 Ga0501072_0007477 3300049588 Bacteria 8290
114 Ga0501073_0062228 3300049589 Bacteria 2603
115 Ga0501080_0084250 3300049742 Bacteria 2953
116 Ga0501278_000650 3300049774 Bacteria 2649
117 Ga0501044_0255296 3300049823 Bacteria 1693
118 nmdc:mga0n895_846940_c1 3300050512 Bacteria 902
119 Ga0500559_0261747 3300053136 Bacteria 814
120 Ga0500636_0045484 3300053177 Bacteria 2589
121 Ga0500645_038611 3300053730 Bacteria 1416

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025934 Ga0207686_10145509 Ga0207686_101455093 181
2 3300045051 Ga0451576_0951833 Ga0451576_0951833_20_598 187
3 3300009094 Ga0111539_11197536 Ga0111539_111975361 189
4 3300049774 Ga0501278_000650 Ga0501278_000650_437_1015 190
5 3300005329 Ga0070683_100510241 Ga0070683_1005102412 192
6 3300025944 Ga0207661_10430671 Ga0207661_104306712 192
7 3300013102 Ga0157371_10364561 Ga0157371_103645611 194
8 3300028800 Ga0265338_10023221 Ga0265338_100232213 194
9 3300037471 Ga0395905_0126732 Ga0395905_0126732_205_804 196
10 3300031238 Ga0265332_10090677 Ga0265332_100906772 198
11 3300031616 Ga0307508_10067131 Ga0307508_100671314 198
12 3300009094 Ga0111539_10002895 Ga0111539_1000289520 200
13 3300027907 Ga0207428_10023732 Ga0207428_100237322 200
14 3300031242 Ga0265329_10001850 Ga0265329_100018502 200
15 3300031711 Ga0265314_10000284 Ga0265314_1000028434 200
16 3300035119 Ga0373956_0167167 Ga0373956_0167167_288_911 200
17 3300042876 Ga0451577_0001251 Ga0451577_0001251_28802_29425 200
18 3300042876 Ga0451577_0570301 Ga0451577_0570301_277_900 200
19 3300044712 Ga0453684_0000254 Ga0453684_0000254_141470_142093 200
20 3300044712 Ga0453684_0708544 Ga0453684_0708544_76_699 200
21 3300005295 Ga0065707_10268721 Ga0065707_102687212 201
22 3300005340 Ga0070689_100013928 Ga0070689_1000139282 201
23 3300005343 Ga0070687_100082129 Ga0070687_1000821293 201
24 3300005354 Ga0070675_100417010 Ga0070675_1004170102 201
25 3300005365 Ga0070688_100004086 Ga0070688_1000040866 201
26 3300005438 Ga0070701_10014153 Ga0070701_100141533 201
27 3300005440 Ga0070705_100058879 Ga0070705_1000588793 201
28 3300005549 Ga0070704_100581365 Ga0070704_1005813652 201
29 3300005577 Ga0068857_100177423 Ga0068857_1001774232 201
30 3300005617 Ga0068859_100279576 Ga0068859_1002795761 201
31 3300005985 Ga0081539_10020840 Ga0081539_100208401 201
32 3300006028 Ga0070717_10037626 Ga0070717_100376263 201
33 3300006844 Ga0075428_100045699 Ga0075428_1000456994 201
34 3300006852 Ga0075433_10619540 Ga0075433_106195402 201
35 3300006931 Ga0097620_100279574 Ga0097620_1002795741 201
36 3300007076 Ga0075435_100910046 Ga0075435_1009100461 201
37 3300009093 Ga0105240_10730499 Ga0105240_107304991 201
38 3300009551 Ga0105238_10452188 Ga0105238_104521882 201
39 3300025936 Ga0207670_10024406 Ga0207670_100244063 201
40 3300025936 Ga0207670_10025228 Ga0207670_100252282 201
41 3300026116 Ga0207674_10210047 Ga0207674_102100472 201
42 3300028800 Ga0265338_10000312 Ga0265338_1000031229 201
43 3300028800 Ga0265338_10000660 Ga0265338_1000066038 201
44 3300042876 Ga0451577_0139866 Ga0451577_0139866_136_771 201
45 3300042876 Ga0451577_0178219 Ga0451577_0178219_352_978 201
46 3300044712 Ga0453684_0031689 Ga0453684_0031689_5068_5703 201
47 3300044712 Ga0453684_0117301 Ga0453684_0117301_1411_2073 201
48 3300045051 Ga0451576_0000453 Ga0451576_0000453_5618_6244 201
49 3300045051 Ga0451576_0154328 Ga0451576_0154328_930_1547 201
50 3300045051 Ga0451576_0536944 Ga0451576_0536944_499_1203 201
51 3300046517 Ga0495630_0300320 Ga0495630_0300320_539_1159 201
52 3300046683 Ga0495658_0038747 Ga0495658_0038747_1526_2143 201
53 3300048908 Ga0496105_0761548 Ga0496105_0761548_54_665 201
54 3300050512 nmdc:mga0n895_846940_c1 nmdc:mga0n895_846940_c1_92_703 201
55 3300038725 Ga0400484_37844 Ga0400484_37844_38_706 202
56 2162886011 MRS1b_contig_4932708 MRS1b_0967.00003250 203
57 3300005290 Ga0065712_10126073 Ga0065712_101260732 203
58 3300005338 Ga0068868_100021449 Ga0068868_1000214497 203
59 3300005338 Ga0068868_100584038 Ga0068868_1005840382 203
60 3300005340 Ga0070689_100689237 Ga0070689_1006892371 203
61 3300005344 Ga0070661_100304741 Ga0070661_1003047412 203
62 3300005353 Ga0070669_100901334 Ga0070669_1009013341 203
63 3300005354 Ga0070675_100083870 Ga0070675_1000838703 203
64 3300005355 Ga0070671_100100720 Ga0070671_1001007203 203
65 3300005444 Ga0070694_100692440 Ga0070694_1006924402 203
66 3300005445 Ga0070708_100290920 Ga0070708_1002909202 203
67 3300005456 Ga0070678_100572247 Ga0070678_1005722472 203
68 3300005518 Ga0070699_100019751 Ga0070699_1000197514 203
69 3300005530 Ga0070679_100392619 Ga0070679_1003926191 203
70 3300005536 Ga0070697_100524832 Ga0070697_1005248322 203
71 3300005548 Ga0070665_100128446 Ga0070665_1001284463 203
72 3300005548 Ga0070665_101145668 Ga0070665_1011456682 203
73 3300005616 Ga0068852_100371505 Ga0068852_1003715052 203
74 3300005617 Ga0068859_100151006 Ga0068859_1001510062 203
75 3300005617 Ga0068859_100403986 Ga0068859_1004039862 203
76 3300005618 Ga0068864_100067870 Ga0068864_1000678704 203
77 3300005718 Ga0068866_10136543 Ga0068866_101365432 203
78 3300006914 Ga0075436_100137954 Ga0075436_1001379542 203
79 3300006931 Ga0097620_100151014 Ga0097620_1001510142 203
80 3300006931 Ga0097620_100403950 Ga0097620_1004039502 203
81 3300009174 Ga0105241_10721455 Ga0105241_107214552 203
82 3300009177 Ga0105248_10013752 Ga0105248_1001375210 203
83 3300009551 Ga0105238_10554008 Ga0105238_105540082 203
84 3300010375 Ga0105239_10014084 Ga0105239_100140847 203
85 3300010375 Ga0105239_10223868 Ga0105239_102238683 203
86 3300013296 Ga0157374_10257323 Ga0157374_102573232 203
87 3300013297 Ga0157378_10032510 Ga0157378_100325103 203
88 3300013306 Ga0163162_10000646 Ga0163162_1000064611 203
89 3300013308 Ga0157375_10071478 Ga0157375_100714784 203
90 3300014325 Ga0163163_10004586 Ga0163163_100045864 203
91 3300014325 Ga0163163_10023922 Ga0163163_100239228 203
92 3300014968 Ga0157379_10177826 Ga0157379_101778262 203
93 3300014969 Ga0157376_10029698 Ga0157376_100296981 203
94 3300025936 Ga0207670_10113438 Ga0207670_101134382 203
95 3300025941 Ga0207711_10084194 Ga0207711_100841944 203
96 3300025960 Ga0207651_10370345 Ga0207651_103703451 203
97 3300026023 Ga0207677_10299197 Ga0207677_102991972 203
98 3300026089 Ga0207648_10269186 Ga0207648_102691861 203
99 3300026095 Ga0207676_10288710 Ga0207676_102887102 203
100 3300026121 Ga0207683_10204094 Ga0207683_102040942 203
101 3300028379 Ga0268266_10501290 Ga0268266_105012902 203
102 3300028380 Ga0268265_10312260 Ga0268265_103122602 203
103 3300028381 Ga0268264_10129390 Ga0268264_101293903 203
104 3300028800 Ga0265338_10254099 Ga0265338_102540993 203
105 3300036401 Ga0373937_0264709 Ga0373937_0264709_665_1294 203
106 3300038726 Ga0400490_20932 Ga0400490_20932_874_1515 203
107 3300039110 Ga0400487_40022 Ga0400487_40022_2696_3337 203
108 3300044712 Ga0453684_0498223 Ga0453684_0498223_603_1277 203
109 3300046543 Ga0495645_0025361 Ga0495645_0025361_249_878 203
110 3300046678 Ga0495599_0319309 Ga0495599_0319309_117_746 203
111 3300047444 Ga0495675_0168552 Ga0495675_0168552_249_878 203
112 3300049570 Ga0501033_0021820 Ga0501033_0021820_2749_3402 203
113 3300049581 Ga0501047_0001549 Ga0501047_0001549_15210_15854 203
114 3300049583 Ga0501067_0012775 Ga0501067_0012775_3661_4305 203
115 3300049588 Ga0501072_0007477 Ga0501072_0007477_3530_4174 203
116 3300049589 Ga0501073_0062228 Ga0501073_0062228_1070_1714 203
117 3300049742 Ga0501080_0084250 Ga0501080_0084250_1962_2606 203
118 3300049823 Ga0501044_0255296 Ga0501044_0255296_346_999 203
119 3300053136 Ga0500559_0261747 Ga0500559_0261747_109_753 203
120 3300053177 Ga0500636_0045484 Ga0500636_0045484_1197_1841 203
121 3300053730 Ga0500645_038611 Ga0500645_038611_13_663 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

10

128

0.87

PF00117

GATase

Glutamine amidotransferase class-I

3

215

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9453 1 198
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9439 3 198
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.9332 4 198
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9208 3 198
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.909 1 198
ID Description Score Start End Superfamily
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9764 4 199 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9568 4 199 3.40.50.880
4gudA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9401 3 198 3.40.50.880
1ka9H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9332 4 198 3.40.50.880
af_P9WMM1_1_205_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9326 1 199 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2V8NKX7-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9951 2 203 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A2V8Q433-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9933 1 199 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A3B9LQV5-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9924 5 199 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A845CHY9-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9915 44 198 GO:0000105
GO:0000107
GO:0006541
GO:0016787
GO:0016829
AF-A0A101G9J7-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9896 4 199 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829

Feature Viewer

pLDDT pTM Quality
94.54 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map