F110866

General Info

Members Datasets Scaffolds Average Seq Length
121 79 242 253

Family's Representative Sequence

Representative Sequence 3300032133|Ga0316583_10036760|Ga0316583_100367601
Length 276
Sequence MDTQMGFLEVDHVAKSFGGLKALQDVSLAVERGEIHAVIGPNGAGKSTLFNVMTGLLAPDSGKVVFNGERISGLPPHRIIRKGVGRSFQITNIFPRMSVFENVQVALFCHYRKSAHAIASARKYQSIARETLEILEQVGLVEKYAGSASVLSHGDQKRLEIAISLASRPKLLMLDEPTAGMSRFESRETVSLLQEISRDQGLTLIFTEHDMDMVFGISEKITVLQQGAVIAGGTPAEIKKNPVVRKAYLGEEDMDEKVVSIHNHPVRHQSGTGNTG

Samples

Sample ID Description Type Environment
1 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
20 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
21 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
31 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
32 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
33 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
34 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
35 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
36 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
37 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
38 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
39 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
40 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
43 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
44 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
45 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
46 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
47 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
48 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
49 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
50 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
51 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
52 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
53 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
54 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
55 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
56 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
57 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
58 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
64 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
65 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
67 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
68 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
69 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
70 2738541295 Bacillus sp. OK085 Isolate Unclassified
71 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
72 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
73 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
74 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
75 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
76 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
77 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
78 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
79 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.43
Metatranscriptomes 3.31
Isolates 8.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 0.83
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316583_10036760 3300032133 Bacteria 1736
2 Ga0070680_100157106 3300005336 Bacteria 1911
3 Ga0070692_10080985 3300005345 Bacteria 1748
4 Ga0070703_10045957 3300005406 Bacteria 1379
5 Ga0070700_100328697 3300005441 Bacteria 1126
6 Ga0070708_100054687 3300005445 Bacteria 3546
7 Ga0070708_100148262 3300005445 Bacteria 2180
8 Ga0070708_100457883 3300005445 Bacteria 1203
9 Ga0070706_100043040 3300005467 Bacteria 4172
10 Ga0070706_100068460 3300005467 Bacteria 3282
11 Ga0070706_100605735 3300005467 Bacteria 1018
12 Ga0070707_100073582 3300005468 Bacteria 3294
13 Ga0070698_100133336 3300005471 Bacteria 2438
14 Ga0070699_100055259 3300005518 Bacteria 3438
15 Ga0070699_100128102 3300005518 Bacteria 2236
16 Ga0070679_100902495 3300005530 Bacteria 827
17 Ga0070697_100045771 3300005536 Bacteria 3546
18 Ga0070697_100167292 3300005536 Bacteria 1859
19 Ga0070704_100219361 3300005549 Bacteria 1545
20 Ga0068870_10024545 3300005840 Bacteria 2984
21 Ga0068862_100177750 3300005844 Bacteria 1909
22 Ga0105250_10185210 3300009092 Bacteria 874
23 Ga0105245_10119856 3300009098 Bacteria 2457
24 Ga0105243_10046358 3300009148 Bacteria 3419
25 Ga0157371_10019360 3300013102 Bacteria 5021
26 Ga0213876_10203670 3300021384 Bacteria 1052
27 Ga0209676_1051667 3300025292 Bacteria 1077
28 Ga0207653_10012587 3300025885 Bacteria 2642
29 Ga0207684_10071079 3300025910 Bacteria 2957
30 Ga0207684_10412269 3300025910 Bacteria 1161
31 Ga0207646_10029309 3300025922 Bacteria 5004
32 Ga0207709_10022121 3300025935 Bacteria 3604
33 Ga0207689_10082759 3300025942 Bacteria 2639
34 Ga0207648_10058665 3300026089 Bacteria 3356
35 Ga0209971_1001003 3300027682 Bacteria 7238
36 Ga0268265_10695542 3300028380 Bacteria 982
37 Ga0265316_10441417 3300031344 Bacteria 934
38 Ga0307408_100140473 3300031548 Bacteria 1895
39 Ga0316575_10000172 3300031665 Bacteria 16621
40 Ga0316575_10002183 3300031665 Bacteria 6531
41 Ga0316575_10007223 3300031665 Bacteria 4018
42 Ga0316575_10044630 3300031665 Bacteria 1759
43 Ga0316579_10009073 3300031691 Bacteria 4173
44 Ga0316576_10001034 3300031727 Bacteria 14393
45 Ga0316576_10001916 3300031727 Bacteria 11592
46 Ga0316576_10045690 3300031727 Bacteria 3168
47 Ga0316576_10162152 3300031727 Bacteria 1686
48 Ga0316576_10182959 3300031727 Unclassified 1580
49 Ga0316578_10002382 3300031728 Bacteria 8217
50 Ga0316578_10002771 3300031728 Bacteria 7808
51 Ga0316577_10000621 3300031733 Bacteria 14698
52 Ga0316577_10008063 3300031733 Bacteria 5632
53 Ga0316577_10039340 3300031733 Bacteria 2646
54 Ga0316577_10112800 3300031733 Bacteria 1526
55 Ga0316577_10166144 3300031733 Bacteria 1245
56 Ga0307409_100332391 3300031995 Bacteria 1426
57 Ga0316583_10001905 3300032133 Bacteria 7122
58 Ga0316585_10000185 3300032137 Bacteria 12686
59 Ga0316585_10043286 3300032137 Bacteria 1437
60 Ga0316580_10000178 3300032139 Bacteria 12663
61 Ga0316580_10017209 3300032139 Bacteria 2221
62 Ga0316588_1001851 3300033528 Bacteria 3585
63 Ga0316596_1000054 3300033541 Bacteria 12550
64 Ga0316574_0000019 3300035398 Bacteria 40791
65 Ga0316574_0000616 3300035398 Bacteria 14853
66 Ga0316574_0000928 3300035398 Bacteria 13047
67 Ga0316574_0001836 3300035398 Bacteria 10350
68 Ga0316574_0052757 3300035398 Bacteria 2537
69 Ga0316574_0063387 3300035398 Bacteria 2324
70 Ga0316574_0188604 3300035398 Unclassified 1326
71 Ga0373927_0213936 3300035695 Bacteria 1266
72 Ga0373947_0005505 3300035725 Bacteria 7388
73 Ga0316582_0004401 3300036647 Bacteria 7112
74 Ga0316582_0018821 3300036647 Bacteria 4028
75 Ga0316582_0028018 3300036647 Bacteria 3409
76 Ga0316582_0223993 3300036647 Bacteria 1286
77 Ga0316582_0242955 3300036647 Unclassified 1234
78 Ga0316584_0002262 3300036712 Bacteria 12106
79 Ga0316584_0073321 3300036712 Bacteria 2566
80 Ga0316584_0083831 3300036712 Bacteria 2387
81 Ga0316584_0090912 3300036712 Bacteria 2285
82 Ga0316584_0094278 3300036712 Bacteria 2241
83 Ga0373925_0047615 3300037068 Bacteria 3192
84 Ga0316581_0102306 3300037588 Bacteria 882
85 Ga0400485_09717 3300038735 Bacteria 5545
86 Ga0400489_32282 3300039093 Bacteria 123730
87 Ga0436365_0777640 3300039437 Bacteria 3129
88 Ga0439441_005461 3300042001 Bacteria 1977
89 Ga0439441_008785 3300042001 Bacteria 1659
90 Ga0453684_0014051 3300044712 Bacteria 12884
91 Ga0453684_0032340 3300044712 Bacteria 7325
92 Ga0453684_0662579 3300044712 Bacteria 1138
93 Ga0453684_0757659 3300044712 Bacteria 1050
94 Ga0453684_1266790 3300044712 Bacteria 771
95 Ga0451576_0022205 3300045051 Bacteria 6885
96 Ga0495629_0421399 3300046459 Bacteria 906
97 Ga0495676_0037860 3300047321 Bacteria 4011
98 Ga0496110_0362975 3300048913 Bacteria 1320
99 Ga0501305_001383 3300049161 Bacteria 2359
100 Ga0501312_000301 3300049528 Bacteria 3675
101 Ga0501033_0318708 3300049570 Bacteria 1092
102 Ga0501034_0095943 3300049571 Bacteria 2962
103 Ga0501046_0434694 3300049580 Bacteria 945
104 Ga0501075_0536414 3300049591 Bacteria 893
105 Ga0501079_0169291 3300049741 Bacteria 1704
106 Ga0501079_0345106 3300049741 Bacteria 1166
107 Ga0501035_0212684 3300049822 Bacteria 1654
108 Ga0501044_0060873 3300049823 Bacteria 3864
109 Ga0590075_008926 3300059424 Bacteria 2399
110 Ga0590077_046610 3300059426 Bacteria 970
111 Ga0501082_0328610 3300060353 Bacteria 1332
112 2738816886 2738541295 Bacteria 5730091
113 2819629583 2818991451 Bacteria 4697364
114 2939594122 2939593269 Bacteria 4798695
115 2964376871 2964375228 Bacteria 4909004
116 2977256129 2977254563 Bacteria 4828420
117 2990277010 2990275345 Bacteria 4887158
118 3001895400 3001892409 Bacteria 6328293
119 3006974286 3006973921 Bacteria 4423788
120 3006978772 3006978542 Bacteria 5328100
121 8055637616 8055632911 Bacteria 5283357
122 Ga0316583_10036760
123 Ga0070680_100157106
124 Ga0070692_10080985
125 Ga0070703_10045957
126 Ga0070700_100328697
127 Ga0070708_100054687
128 Ga0070708_100148262
129 Ga0070708_100457883
130 Ga0070706_100043040
131 Ga0070706_100068460
132 Ga0070706_100605735
133 Ga0070707_100073582
134 Ga0070698_100133336
135 Ga0070699_100055259
136 Ga0070699_100128102
137 Ga0070679_100902495
138 Ga0070697_100045771
139 Ga0070697_100167292
140 Ga0070704_100219361
141 Ga0068870_10024545
142 Ga0068862_100177750
143 Ga0105250_10185210
144 Ga0105245_10119856
145 Ga0105243_10046358
146 Ga0157371_10019360
147 Ga0213876_10203670
148 Ga0209676_1051667
149 Ga0207653_10012587
150 Ga0207684_10071079
151 Ga0207684_10412269
152 Ga0207646_10029309
153 Ga0207709_10022121
154 Ga0207689_10082759
155 Ga0207648_10058665
156 Ga0209971_1001003
157 Ga0268265_10695542
158 Ga0265316_10441417
159 Ga0307408_100140473
160 Ga0316575_10000172
161 Ga0316575_10002183
162 Ga0316575_10007223
163 Ga0316575_10044630
164 Ga0316579_10009073
165 Ga0316576_10001034
166 Ga0316576_10001916
167 Ga0316576_10045690
168 Ga0316576_10162152
169 Ga0316576_10182959
170 Ga0316578_10002382
171 Ga0316578_10002771
172 Ga0316577_10000621
173 Ga0316577_10008063
174 Ga0316577_10039340
175 Ga0316577_10112800
176 Ga0316577_10166144
177 Ga0307409_100332391
178 Ga0316583_10001905
179 Ga0316585_10000185
180 Ga0316585_10043286
181 Ga0316580_10000178
182 Ga0316580_10017209
183 Ga0316588_1001851
184 Ga0316596_1000054
185 Ga0316574_0000019
186 Ga0316574_0000616
187 Ga0316574_0000928
188 Ga0316574_0001836
189 Ga0316574_0052757
190 Ga0316574_0063387
191 Ga0316574_0188604
192 Ga0373927_0213936
193 Ga0373947_0005505
194 Ga0316582_0004401
195 Ga0316582_0018821
196 Ga0316582_0028018
197 Ga0316582_0223993
198 Ga0316582_0242955
199 Ga0316584_0002262
200 Ga0316584_0073321
201 Ga0316584_0083831
202 Ga0316584_0090912
203 Ga0316584_0094278
204 Ga0373925_0047615
205 Ga0316581_0102306
206 Ga0400485_09717
207 Ga0400489_32282
208 Ga0436365_0777640
209 Ga0439441_005461
210 Ga0439441_008785
211 Ga0453684_0014051
212 Ga0453684_0032340
213 Ga0453684_0662579
214 Ga0453684_0757659
215 Ga0453684_1266790
216 Ga0451576_0022205
217 Ga0495629_0421399
218 Ga0495676_0037860
219 Ga0496110_0362975
220 Ga0501305_001383
221 Ga0501312_000301
222 Ga0501033_0318708
223 Ga0501034_0095943
224 Ga0501046_0434694
225 Ga0501075_0536414
226 Ga0501079_0169291
227 Ga0501079_0345106
228 Ga0501035_0212684
229 Ga0501044_0060873
230 Ga0590075_008926
231 Ga0590077_046610
232 Ga0501082_0328610
233 2738816886
234 2819629583
235 2939594122
236 2964376871
237 2977256129
238 2990277010
239 3001895400
240 3006974286
241 3006978772
242 8055637616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

228

254

0.96

PF00005

ABC_tran

ABC transporter

23

179

0.94

PF13555

AAA_29

P-loop containing region of AAA domain

18

69

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.93 5 236
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9282 5 236
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.927 7 235
3rlf-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.9212 6 235
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9204 6 235
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9538 7 248 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.943 5 239 3.40.50.300
af_Q1RS86_918_1157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9422 2 221 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9383 6 230 3.40.50.300
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9373 1 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y0LYI9-F1-model_v4 ABC transporter ATP-binding protein 0.9625 4 247 GO:0005524
GO:0005886
GO:0016887
AF-A0A3S4XSM4-F1-model_v4 ABC transporter ATP-binding protein 0.9587 27 247 GO:0005524
GO:0005886
GO:0016887
AF-A0A1F9F244-F1-model_v4 ABC transporter ATP-binding protein 0.958 4 192 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A815R428-F1-model_v4 ABC transporter domain-containing protein 0.9549 2 236 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359
AF-A0A7V7XMM8-F1-model_v4 ABC transporter ATP-binding protein 0.9538 2 249 GO:0005524
GO:0005886
GO:0016887

Map