F110832

General Info

Members Datasets Scaffolds Average Seq Length
121 90 121 372

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100390522|Ga0307409_1003905222
Length 401
Sequence MRFVLFYHSLVSDWNHGNAHFLRGVVTELQARGHDVRVYEPRDGWSLQNLRAEHGEVPVEGFHDAYPGLSSTAYDLRTLDLDAALDGADAVIVHEWSDHDLVRRIGEHRARRGRASSGAYSLLFHDTHHRAVTEPASMARYDLSHYDGVLAYGRVLKDLYLARGWTRRAWTWHEAADTRVFHPVDGQPAEGDVVWVGNWGDDERTAELHEFLLGPVKALGLRARVHGVRYPDAALAALKDAGIEYGGWLPNYAAPAVFARFKATVHVPRRPYVEALPGIPTIRPFEALACGIPLVCSPWDDAEHLFTPGKDYLVARDGEEMKRHLRTVMNEPQVARELAERGRRTILARHTCGHRVDELMAVLGELGDGDVRVKRTRRDAKPQAAGGRRLAASGAKGGNSQ

Samples

Sample ID Description Type Environment
1 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
32 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
35 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
65 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
73 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
76 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
77 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
80 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
83 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
84 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
85 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
86 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
87 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
88 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
89 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
90 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.31
Nodule 0
Rhizoplane 3.31
Rhizosphere 85.12
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0032354_1033175 3300003693 Bacteria 5039
2 Ga0058692_1000006 3300003856 Bacteria 398109
3 Ga0065712_10005450 3300005290 Bacteria 3395
4 Ga0070683_100000787 3300005329 Bacteria 23394
5 Ga0070683_100368479 3300005329 Bacteria 1368
6 Ga0070690_100005154 3300005330 Bacteria 7317
7 Ga0070670_100040081 3300005331 Bacteria 4028
8 Ga0070682_100000026 3300005337 Bacteria 191388
9 Ga0068868_100215759 3300005338 Bacteria 1605
10 Ga0070689_100042738 3300005340 Bacteria 3481
11 Ga0070661_100037054 3300005344 Bacteria 3547
12 Ga0070673_100187681 3300005364 Bacteria 1774
13 Ga0070688_100000028 3300005365 Bacteria 67085
14 Ga0070688_100101024 3300005365 Bacteria 1902
15 Ga0070678_100031471 3300005456 Bacteria 3661
16 Ga0070685_10008594 3300005466 Bacteria 5254
17 Ga0070672_100298818 3300005543 Bacteria 1364
18 Ga0070665_100000411 3300005548 Bacteria 62752
19 Ga0070665_100105750 3300005548 Bacteria 2816
20 Ga0068856_100001373 3300005614 Bacteria 25601
21 Ga0068856_100023983 3300005614 Bacteria 5934
22 Ga0068852_100000022 3300005616 Bacteria 125196
23 Ga0068863_100055460 3300005841 Bacteria 3752
24 Ga0068860_100381085 3300005843 Bacteria 1392
25 Ga0075365_10076819 3300006038 Bacteria 2255
26 Ga0068865_100000040 3300006881 Bacteria 72979
27 Ga0105242_10116280 3300009176 Bacteria 2288
28 Ga0105248_10076961 3300009177 Bacteria 3750
29 Ga0105237_10143983 3300009545 Bacteria 2378
30 Ga0157371_10002779 3300013102 Bacteria 16418
31 Ga0157374_10109408 3300013296 Bacteria 2657
32 Ga0157378_10037296 3300013297 Bacteria 4304
33 Ga0163162_10176225 3300013306 Bacteria 2264
34 Ga0163163_10053589 3300014325 Bacteria 3982
35 Ga0182006_1023473 3300015261 Bacteria 2554
36 Ga0213874_10014017 3300021377 Bacteria 2089
37 Ga0213875_10000013 3300021388 Bacteria 305595
38 Ga0213875_10001132 3300021388 Bacteria 18346
39 Ga0213875_10003691 3300021388 Bacteria 8633
40 Ga0207673_1003743 3300025290 Bacteria 1791
41 Ga0207697_10022198 3300025315 Bacteria 2600
42 Ga0207687_10281929 3300025927 Bacteria 1332
43 Ga0207670_10124076 3300025936 Bacteria 1882
44 Ga0207704_10000079 3300025938 Bacteria 58183
45 Ga0207711_10000011 3300025941 Bacteria 518817
46 Ga0207711_10119139 3300025941 Bacteria 2355
47 Ga0207651_10208589 3300025960 Bacteria 1571
48 Ga0207658_10232247 3300025986 Bacteria 1558
49 Ga0207677_10102473 3300026023 Bacteria 2110
50 Ga0207677_10238548 3300026023 Bacteria 1469
51 Ga0207678_10020390 3300026067 Bacteria 5814
52 Ga0207702_10000337 3300026078 Bacteria 53931
53 Ga0207702_10017412 3300026078 Bacteria 5946
54 Ga0207641_10240931 3300026088 Bacteria 1685
55 Ga0207675_100151001 3300026118 Bacteria 2211
56 Ga0207698_10000015 3300026142 Bacteria 207368
57 Ga0209371_1000016 3300027312 Bacteria 646301
58 Ga0268266_10001851 3300028379 Bacteria 23887
59 Ga0268266_10051503 3300028379 Bacteria 3534
60 Ga0268256_1000015 3300030500 Bacteria 646300
61 Ga0307408_100114690 3300031548 Bacteria 2076
62 Ga0307405_10104371 3300031731 Bacteria 1907
63 Ga0307413_10003485 3300031824 Bacteria 6629
64 Ga0307413_10004795 3300031824 Bacteria 5941
65 Ga0307410_10004154 3300031852 Bacteria 7423
66 Ga0307410_10006236 3300031852 Bacteria 6417
67 Ga0307406_10013086 3300031901 Bacteria 4744
68 Ga0307407_10004503 3300031903 Bacteria 5928
69 Ga0307407_10008946 3300031903 Bacteria 4632
70 Ga0307407_10071466 3300031903 Bacteria 2066
71 Ga0307409_100000202 3300031995 Bacteria 23457
72 Ga0307409_100060557 3300031995 Bacteria 2953
73 Ga0307409_100228383 3300031995 Bacteria 1685
74 Ga0307409_100390522 3300031995 Bacteria 1326
75 Ga0307416_100008244 3300032002 Bacteria 6702
76 Ga0307416_100063505 3300032002 Bacteria 3024
77 Ga0307416_100110362 3300032002 Bacteria 2422
78 Ga0307416_100158892 3300032002 Bacteria 2086
79 Ga0307416_100267976 3300032002 Bacteria 1674
80 Ga0307414_10284373 3300032004 Bacteria 1391
81 Ga0307411_10005393 3300032005 Bacteria 6276
82 Ga0307411_10085958 3300032005 Bacteria 2180
83 Ga0307411_10147016 3300032005 Bacteria 1746
84 Ga0307415_100002082 3300032126 Bacteria 9892
85 Ga0307415_100010086 3300032126 Bacteria 5331
86 Ga0436364_0566500 3300037853 Bacteria 56428
87 Ga0436364_0794765 3300037853 Bacteria 162685
88 Ga0436364_1032338 3300037853 Bacteria 9750
89 Ga0436365_0746675 3300039437 Bacteria 2327
90 Ga0436363_0150745 3300039450 Bacteria 3949
91 Ga0436363_0895717 3300039450 Unclassified 1767
92 Ga0436362_1305658 3300039453 Unclassified 2099
93 Ga0451577_0000009 3300042876 Bacteria 646744
94 Ga0453683_0038578 3300044673 Bacteria 3003
95 Ga0453684_0000241 3300044712 Bacteria 235032
96 Ga0453684_0000567 3300044712 Bacteria 138873
97 Ga0453684_0005878 3300044712 Bacteria 23825
98 Ga0466957_0006980 3300044842 Bacteria 6383
99 Ga0466957_0063028 3300044842 Bacteria 2278
100 Ga0451576_0013297 3300045051 Bacteria 9208
101 Ga0466967_0575803 3300045976 Bacteria 1110
102 Ga0495606_0000017 3300046507 Bacteria 284549
103 Ga0495658_0000332 3300046683 Bacteria 26498
104 Ga0496110_0000241 3300048913 Bacteria 35518
105 Ga0496111_0000011 3300048914 Bacteria 88409
106 Ga0496112_0268059 3300048915 Bacteria 1656
107 Ga0496115_0000749 3300048918 Bacteria 23899
108 Ga0501034_0040586 3300049571 Bacteria 4710
109 Ga0501067_0073507 3300049583 Bacteria 1894
110 Ga0501068_0202594 3300049584 Bacteria 1259
111 Ga0501070_0020475 3300049586 Bacteria 5547
112 Ga0501070_0039409 3300049586 Bacteria 3941
113 Ga0501073_0108870 3300049589 Bacteria 1923
114 Ga0501259_007095 3300049688 Bacteria 1792
115 Ga0501080_0176991 3300049742 Bacteria 1965
116 Ga0501268_011792 3300049765 Bacteria 1386
117 Ga0501035_0000330 3300049822 Bacteria 55037
118 Ga0500635_0010051 3300053080 Bacteria 2646
119 Ga0495619_0000054 3300053085 Bacteria 97928
120 Ga0500578_0120581 3300053086 Bacteria 1648
121 Ga0500566_0005176 3300053094 Bacteria 7769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0575803 Ga0466967_0575803_39_1082 332
2 3300048913 Ga0496110_0000241 Ga0496110_0000241_20139_21143 332
3 3300048914 Ga0496111_0000011 Ga0496111_0000011_20114_21118 332
4 3300005337 Ga0070682_100000026 Ga0070682_10000002634 333
5 3300053085 Ga0495619_0000054 Ga0495619_0000054_19893_20900 333
6 3300046683 Ga0495658_0000332 Ga0495658_0000332_21549_22571 337
7 3300044712 Ga0453684_0000567 Ga0453684_0000567_40918_41946 338
8 3300005548 Ga0070665_100000411 Ga0070665_10000041146 339
9 3300028379 Ga0268266_10001851 Ga0268266_1000185116 339
10 3300031995 Ga0307409_100228383 Ga0307409_1002283832 348
11 3300032002 Ga0307416_100158892 Ga0307416_1001588922 348
12 3300032005 Ga0307411_10005393 Ga0307411_100053932 348
13 3300021388 Ga0213875_10001132 Ga0213875_100011329 349
14 3300037853 Ga0436364_0566500 Ga0436364_0566500_47780_48895 349
15 3300044842 Ga0466957_0063028 Ga0466957_0063028_838_1950 353
16 3300005290 Ga0065712_10005450 Ga0065712_100054502 356
17 3300005364 Ga0070673_100187681 Ga0070673_1001876812 356
18 3300005365 Ga0070688_100101024 Ga0070688_1001010242 356
19 3300005466 Ga0070685_10008594 Ga0070685_100085944 356
20 3300005548 Ga0070665_100105750 Ga0070665_1001057502 356
21 3300009176 Ga0105242_10116280 Ga0105242_101162802 356
22 3300013296 Ga0157374_10109408 Ga0157374_101094082 356
23 3300013306 Ga0163162_10176225 Ga0163162_101762252 356
24 3300025290 Ga0207673_1003743 Ga0207673_10037432 356
25 3300025315 Ga0207697_10022198 Ga0207697_100221982 356
26 3300025927 Ga0207687_10281929 Ga0207687_102819292 356
27 3300025936 Ga0207670_10124076 Ga0207670_101240762 356
28 3300025960 Ga0207651_10208589 Ga0207651_102085891 356
29 3300025986 Ga0207658_10232247 Ga0207658_102322472 356
30 3300026023 Ga0207677_10102473 Ga0207677_101024732 356
31 3300028379 Ga0268266_10051503 Ga0268266_100515032 356
32 3300049822 Ga0501035_0000330 Ga0501035_0000330_27200_28339 356
33 3300015261 Ga0182006_1023473 Ga0182006_10234733 362
34 3300039450 Ga0436363_0895717 Ga0436363_0895717_604_1719 365
35 3300049584 Ga0501068_0202594 Ga0501068_0202594_71_1204 366
36 3300049586 Ga0501070_0020475 Ga0501070_0020475_2469_3602 366
37 3300049586 Ga0501070_0039409 Ga0501070_0039409_2173_3306 366
38 3300049589 Ga0501073_0108870 Ga0501073_0108870_545_1678 366
39 3300003856 Ga0058692_1000006 Ga0058692_1000006134 368
40 3300006881 Ga0068865_100000040 Ga0068865_1000000402 368
41 3300025938 Ga0207704_10000079 Ga0207704_1000007963 368
42 3300027312 Ga0209371_1000016 Ga0209371_1000016136 368
43 3300030500 Ga0268256_1000015 Ga0268256_1000015435 368
44 3300031548 Ga0307408_100114690 Ga0307408_1001146902 368
45 3300031731 Ga0307405_10104371 Ga0307405_101043712 368
46 3300031903 Ga0307407_10071466 Ga0307407_100714662 368
47 3300032002 Ga0307416_100267976 Ga0307416_1002679762 368
48 3300049571 Ga0501034_0040586 Ga0501034_0040586_590_1711 368
49 3300049583 Ga0501067_0073507 Ga0501067_0073507_440_1561 368
50 3300049742 Ga0501080_0176991 Ga0501080_0176991_412_1527 368
51 3300005329 Ga0070683_100000787 Ga0070683_10000078710 369
52 3300005329 Ga0070683_100368479 Ga0070683_1003684791 369
53 3300005331 Ga0070670_100040081 Ga0070670_1000400813 369
54 3300005338 Ga0068868_100215759 Ga0068868_1002157591 369
55 3300005344 Ga0070661_100037054 Ga0070661_1000370543 369
56 3300005365 Ga0070688_100000028 Ga0070688_10000002875 369
57 3300005456 Ga0070678_100031471 Ga0070678_1000314713 369
58 3300005543 Ga0070672_100298818 Ga0070672_1002988182 369
59 3300005614 Ga0068856_100001373 Ga0068856_10000137318 369
60 3300005614 Ga0068856_100023983 Ga0068856_1000239832 369
61 3300005616 Ga0068852_100000022 Ga0068852_10000002213 369
62 3300005841 Ga0068863_100055460 Ga0068863_1000554603 369
63 3300006038 Ga0075365_10076819 Ga0075365_100768192 369
64 3300009177 Ga0105248_10076961 Ga0105248_100769612 369
65 3300009545 Ga0105237_10143983 Ga0105237_101439832 369
66 3300013102 Ga0157371_10002779 Ga0157371_100027794 369
67 3300014325 Ga0163163_10053589 Ga0163163_100535892 369
68 3300021377 Ga0213874_10014017 Ga0213874_100140172 369
69 3300021388 Ga0213875_10000013 Ga0213875_10000013161 369
70 3300021388 Ga0213875_10003691 Ga0213875_100036915 369
71 3300025941 Ga0207711_10000011 Ga0207711_10000011477 369
72 3300025941 Ga0207711_10119139 Ga0207711_101191392 369
73 3300026023 Ga0207677_10238548 Ga0207677_102385482 369
74 3300026067 Ga0207678_10020390 Ga0207678_100203904 369
75 3300026078 Ga0207702_10000337 Ga0207702_1000033754 369
76 3300026078 Ga0207702_10017412 Ga0207702_100174122 369
77 3300026088 Ga0207641_10240931 Ga0207641_102409312 369
78 3300026118 Ga0207675_100151001 Ga0207675_1001510012 369
79 3300026142 Ga0207698_10000015 Ga0207698_100000155 369
80 3300031824 Ga0307413_10003485 Ga0307413_100034853 369
81 3300031824 Ga0307413_10004795 Ga0307413_100047956 369
82 3300031852 Ga0307410_10004154 Ga0307410_100041545 369
83 3300031852 Ga0307410_10006236 Ga0307410_100062366 369
84 3300031901 Ga0307406_10013086 Ga0307406_100130864 369
85 3300031903 Ga0307407_10004503 Ga0307407_100045035 369
86 3300031903 Ga0307407_10008946 Ga0307407_100089464 369
87 3300031995 Ga0307409_100000202 Ga0307409_1000002029 369
88 3300031995 Ga0307409_100060557 Ga0307409_1000605573 369
89 3300031995 Ga0307409_100390522 Ga0307409_1003905222 369
90 3300032002 Ga0307416_100008244 Ga0307416_1000082442 369
91 3300032002 Ga0307416_100063505 Ga0307416_1000635052 369
92 3300032002 Ga0307416_100110362 Ga0307416_1001103622 369
93 3300032004 Ga0307414_10284373 Ga0307414_102843732 369
94 3300032005 Ga0307411_10085958 Ga0307411_100859582 369
95 3300032126 Ga0307415_100002082 Ga0307415_1000020827 369
96 3300032126 Ga0307415_100010086 Ga0307415_1000100863 369
97 3300037853 Ga0436364_0794765 Ga0436364_0794765_133881_135008 369
98 3300037853 Ga0436364_1032338 Ga0436364_1032338_3476_4627 369
99 3300039437 Ga0436365_0746675 Ga0436365_0746675_505_1650 369
100 3300039450 Ga0436363_0150745 Ga0436363_0150745_2187_3332 369
101 3300039453 Ga0436362_1305658 Ga0436362_1305658_699_1835 369
102 3300042876 Ga0451577_0000009 Ga0451577_0000009_561815_562948 369
103 3300044673 Ga0453683_0038578 Ga0453683_0038578_1307_2440 369
104 3300044712 Ga0453684_0000241 Ga0453684_0000241_150105_151238 369
105 3300044712 Ga0453684_0005878 Ga0453684_0005878_12726_13847 369
106 3300044842 Ga0466957_0006980 Ga0466957_0006980_900_2063 369
107 3300045051 Ga0451576_0013297 Ga0451576_0013297_1693_2826 369
108 3300046507 Ga0495606_0000017 Ga0495606_0000017_147200_148315 369
109 3300048915 Ga0496112_0268059 Ga0496112_0268059_20_1165 369
110 3300048918 Ga0496115_0000749 Ga0496115_0000749_9905_11257 369
111 3300049688 Ga0501259_007095 Ga0501259_007095_124_1263 369
112 3300049765 Ga0501268_011792 Ga0501268_011792_75_1214 369
113 3300005330 Ga0070690_100005154 Ga0070690_1000051547 370
114 3300005843 Ga0068860_100381085 Ga0068860_1003810852 370
115 3300005340 Ga0070689_100042738 Ga0070689_1000427382 371
116 3300013297 Ga0157378_10037296 Ga0157378_100372964 371
117 3300032005 Ga0307411_10147016 Ga0307411_101470162 371
118 3300053080 Ga0500635_0010051 Ga0500635_0010051_1223_2365 371
119 3300053086 Ga0500578_0120581 Ga0500578_0120581_102_1244 371
120 3300053094 Ga0500566_0005176 Ga0500566_0005176_4910_6052 371
121 3300003693 Ga0032354_1033175 Ga0032354_10331753 373

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

204

361

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vfk-assembly1.cif.gz_B crystal structure of sdgb (ligand-free form) 0.7349 94 369
7vfm-assembly2.cif.gz_C crystal structure of sdgb (udp and sd peptide-binding form) 0.7277 94 369
3mbo-assembly1.cif.gz_A crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.7227 2 364
7ec1-assembly1.cif.gz_B crystal structure of sdgb (ligand-free form) 0.7192 89 369
7qsg-assembly2.cif.gz_B methylmannose polysaccharide mannosyltransferase from m. hassiacum 0.7181 1 364
ID Description Score Start End Superfamily
af_A4FUP9_153_322_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7979 189 345 3.40.50.2000
1c3jA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7924 178 343 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7924 189 346 3.40.50.2000
af_P96407_190_356_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7827 184 342 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7787 189 346 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2V6GRC8-F1-model_v4 Glycosyltransferase 0.9835 1 365 GO:0016740
AF-A0A1L6L1V1-F1-model_v4 deleted 0.9827 1 364
AF-A0A3A4N4Q8-F1-model_v4 Glycosyltransferase 0.9804 1 365 GO:0016740
AF-A0A2V6GRC8-F1-model_v4 Glycosyltransferase 0.9781 1 365 GO:0016740
AF-A0A7W1AXB9-F1-model_v4 Glycosyltransferase 0.9748 1 294 GO:0016740

Feature Viewer

pLDDT pTM Quality
91.4 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map