F110423

General Info

Members Datasets Scaffolds Average Seq Length
121 91 121 123

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10175254|Ga0207690_101752542
Length 148
Sequence MRSALVIEILFVAALCRRVVASWLRLSRMSRHIATPSIIAAAGNKPKVIEEFVGRVNSGDGGVSIARMKSPSGWVEPGQTPEFDEYTVVLRGTLRVTTRAGSTDVHAGQAVVAQKGEWVQYSTPGDDGAEYIAVCVPAFSMESVHRDA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
70 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
71 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
72 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
83 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
84 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
87 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
91 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.65
Rhizosphere 92.56
Stem 0
Stem Tuber 0
Unclassified 5.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100654210 3300005329 Bacteria 1006
2 Ga0070690_100655390 3300005330 Unclassified 802
3 Ga0068868_101207617 3300005338 Unclassified 699
4 Ga0070689_100015395 3300005340 Bacteria 5576
5 Ga0070674_100250351 3300005356 Bacteria 1391
6 Ga0070673_100351839 3300005364 Bacteria 1308
7 Ga0070667_101987491 3300005367 Bacteria 548
8 Ga0070708_100132971 3300005445 Bacteria 2303
9 Ga0070685_10080167 3300005466 Bacteria 1955
10 Ga0070706_100085316 3300005467 Bacteria 2926
11 Ga0070706_100518168 3300005467 Bacteria 1109
12 Ga0070707_100002971 3300005468 Bacteria 16086
13 Ga0070707_101906328 3300005468 Bacteria 562
14 Ga0070699_100481169 3300005518 Bacteria 1127
15 Ga0070699_101377689 3300005518 Bacteria 647
16 Ga0070684_100116670 3300005535 Bacteria 2398
17 Ga0068853_100683183 3300005539 Unclassified 978
18 Ga0070696_100145594 3300005546 Bacteria 1735
19 Ga0070693_100063361 3300005547 Bacteria 2154
20 Ga0070665_101771707 3300005548 Bacteria 624
21 Ga0070704_100538387 3300005549 Unclassified 1019
22 Ga0070704_101031416 3300005549 Bacteria 745
23 Ga0068855_100233935 3300005563 Bacteria 2056
24 Ga0070664_101024993 3300005564 Bacteria 776
25 Ga0068857_100049505 3300005577 Bacteria 3727
26 Ga0068852_101699134 3300005616 Unclassified 654
27 Ga0068859_101303322 3300005617 Unclassified 800
28 Ga0068864_101560406 3300005618 Bacteria 664
29 Ga0070717_11679010 3300006028 Unclassified 575
30 Ga0070716_100346182 3300006173 Bacteria 1050
31 Ga0070712_101212998 3300006175 Unclassified 656
32 Ga0075428_102197083 3300006844 Bacteria 569
33 Ga0075431_100073892 3300006847 Bacteria 3518
34 Ga0075431_100324231 3300006847 Bacteria 1552
35 Ga0075429_100082186 3300006880 Bacteria 2808
36 Ga0097620_101303599 3300006931 Unclassified 800
37 Ga0075435_100031959 3300007076 Bacteria 4153
38 Ga0075435_100107031 3300007076 Unclassified 2322
39 Ga0075435_100129686 3300007076 Bacteria 2109
40 Ga0105240_10207851 3300009093 Bacteria 2289
41 Ga0111539_10000092 3300009094 Bacteria 94116
42 Ga0111539_10000441 3300009094 Bacteria 52338
43 Ga0111539_12356811 3300009094 Unclassified 618
44 Ga0105245_10224430 3300009098 Bacteria 1814
45 Ga0105245_10247124 3300009098 Bacteria 1732
46 Ga0105245_12782599 3300009098 Bacteria 542
47 Ga0114129_12328507 3300009147 Bacteria 642
48 Ga0105241_10104424 3300009174 Bacteria 2257
49 Ga0105241_10240029 3300009174 Bacteria 1531
50 Ga0105242_10830747 3300009176 Unclassified 917
51 Ga0105237_10000576 3300009545 Bacteria 51366
52 Ga0105237_10083631 3300009545 Bacteria 3182
53 Ga0105238_10001400 3300009551 Bacteria 24199
54 Ga0105239_10048009 3300010375 Bacteria 4680
55 Ga0105239_10224463 3300010375 Bacteria 2107
56 Ga0157378_10717621 3300013297 Bacteria 1020
57 Ga0157378_10764193 3300013297 Unclassified 990
58 Ga0163162_10003551 3300013306 Bacteria 14924
59 Ga0157372_10328156 3300013307 Bacteria 1782
60 Ga0157375_11216232 3300013308 Bacteria 884
61 Ga0157379_10463969 3300014968 Bacteria 1171
62 Ga0213873_10000018 3300021358 Bacteria 123140
63 Ga0213876_10000058 3300021384 Bacteria 134080
64 Ga0213876_10619495 3300021384 Bacteria 576
65 Ga0213875_10074800 3300021388 Bacteria 1580
66 Ga0207684_10164603 3300025910 Bacteria 1910
67 Ga0207695_10212190 3300025913 Unclassified 1846
68 Ga0207671_10000532 3300025914 Bacteria 51370
69 Ga0207646_10006894 3300025922 Bacteria 11668
70 Ga0207694_10016855 3300025924 Bacteria 5520
71 Ga0207687_10067194 3300025927 Bacteria 2549
72 Ga0207690_10175254 3300025932 Bacteria 1610
73 Ga0207670_10010985 3300025936 Bacteria 5234
74 Ga0207669_10226935 3300025937 Bacteria 1375
75 Ga0207665_11010773 3300025939 Bacteria 662
76 Ga0207651_10923323 3300025960 Unclassified 778
77 Ga0207712_11974290 3300025961 Bacteria 522
78 Ga0207639_10000013 3300026041 Bacteria 293084
79 Ga0207639_11259048 3300026041 Bacteria 694
80 Ga0207641_12616735 3300026088 Bacteria 502
81 Ga0207674_10032284 3300026116 Bacteria 5494
82 Ga0207675_100459937 3300026118 Bacteria 1262
83 Ga0207428_10005293 3300027907 Bacteria 12045
84 Ga0207428_10017398 3300027907 Bacteria 6171
85 Ga0265316_10411139 3300031344 Unclassified 974
86 Ga0316576_10375002 3300031727 Bacteria 1057
87 Ga0316576_10408502 3300031727 Bacteria 1006
88 Ga0316583_10005640 3300032133 Bacteria 4500
89 Ga0373953_0050866 3300035117 Bacteria 1674
90 Ga0436364_0005241 3300037853 Bacteria 2495
91 Ga0400483_224996 3300039062 Bacteria 1591
92 Ga0436365_0337700 3300039437 Bacteria 40984
93 Ga0436365_1507494 3300039437 Unclassified 558
94 Ga0436360_0622357 3300039438 Bacteria 1624
95 Ga0436362_0011715 3300039453 Bacteria 44760
96 Ga0436362_0848683 3300039453 Bacteria 605
97 Ga0451793_0286567 3300041452 Bacteria 705
98 Ga0453684_0014517 3300044712 Bacteria 12579
99 Ga0453684_0026426 3300044712 Bacteria 8383
100 Ga0453684_0107007 3300044712 Bacteria 3406
101 Ga0453684_0950126 3300044712 Bacteria 917
102 Ga0453684_2214564 3300044712 Unclassified 548
103 Ga0451576_0191246 3300045051 Bacteria 2138
104 Ga0451576_1563070 3300045051 Unclassified 685
105 Ga0495580_0065483 3300046472 Bacteria 2545
106 Ga0495652_0869042 3300046529 Unclassified 597
107 Ga0495586_0009164 3300046535 Bacteria 5266
108 Ga0495680_0207045 3300047322 Bacteria 1405
109 Ga0495684_0196766 3300047471 Unclassified 1488
110 Ga0495602_0123819 3300048088 Bacteria 2075
111 Ga0496110_0961913 3300048913 Bacteria 761
112 Ga0501044_0570349 3300049823 Unclassified 1027
113 nmdc:mga09592_74817_c1 3300050508 Bacteria 2878
114 nmdc:mga06r32_51460_c1 3300050510 Bacteria 3942
115 nmdc:mga08y16_17702_c1 3300050511 Bacteria 7505
116 nmdc:mga08y16_602_c1 3300050511 Bacteria 33574
117 nmdc:mga0n895_1719513_c1 3300050512 Unclassified 589
118 nmdc:mga0n895_235501_c1 3300050512 Bacteria 1858
119 nmdc:mga0rr50_1833_c1 3300050513 Bacteria 11758
120 nmdc:mga0rr50_5213_c1 3300050513 Bacteria 7730
121 nmdc:mga0rr50_86477_c1 3300050513 Bacteria 2432

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10328156 Ga0157372_103281562 118
2 3300005539 Ga0068853_100683183 Ga0068853_1006831832 119
3 3300006028 Ga0070717_11679010 Ga0070717_116790102 119
4 3300009093 Ga0105240_10207851 Ga0105240_102078512 119
5 3300009098 Ga0105245_12782599 Ga0105245_127825991 119
6 3300005330 Ga0070690_100655390 Ga0070690_1006553902 120
7 3300005338 Ga0068868_101207617 Ga0068868_1012076171 120
8 3300005340 Ga0070689_100015395 Ga0070689_1000153957 120
9 3300005356 Ga0070674_100250351 Ga0070674_1002503512 120
10 3300005364 Ga0070673_100351839 Ga0070673_1003518392 120
11 3300005367 Ga0070667_101987491 Ga0070667_1019874911 120
12 3300005445 Ga0070708_100132971 Ga0070708_1001329712 120
13 3300005466 Ga0070685_10080167 Ga0070685_100801674 120
14 3300005467 Ga0070706_100085316 Ga0070706_1000853161 120
15 3300005467 Ga0070706_100518168 Ga0070706_1005181682 120
16 3300005468 Ga0070707_100002971 Ga0070707_10000297112 120
17 3300005468 Ga0070707_101906328 Ga0070707_1019063281 120
18 3300005518 Ga0070699_100481169 Ga0070699_1004811692 120
19 3300005518 Ga0070699_101377689 Ga0070699_1013776891 120
20 3300005546 Ga0070696_100145594 Ga0070696_1001455942 120
21 3300005547 Ga0070693_100063361 Ga0070693_1000633612 120
22 3300005548 Ga0070665_101771707 Ga0070665_1017717072 120
23 3300005549 Ga0070704_100538387 Ga0070704_1005383871 120
24 3300005549 Ga0070704_101031416 Ga0070704_1010314162 120
25 3300005564 Ga0070664_101024993 Ga0070664_1010249931 120
26 3300005616 Ga0068852_101699134 Ga0068852_1016991341 120
27 3300005617 Ga0068859_101303322 Ga0068859_1013033222 120
28 3300005618 Ga0068864_101560406 Ga0068864_1015604061 120
29 3300006173 Ga0070716_100346182 Ga0070716_1003461823 120
30 3300006175 Ga0070712_101212998 Ga0070712_1012129981 120
31 3300006844 Ga0075428_102197083 Ga0075428_1021970831 120
32 3300006847 Ga0075431_100073892 Ga0075431_1000738922 120
33 3300006931 Ga0097620_101303599 Ga0097620_1013035992 120
34 3300007076 Ga0075435_100031959 Ga0075435_1000319592 120
35 3300007076 Ga0075435_100107031 Ga0075435_1001070312 120
36 3300009094 Ga0111539_10000092 Ga0111539_1000009210 120
37 3300009094 Ga0111539_10000441 Ga0111539_1000044129 120
38 3300009094 Ga0111539_12356811 Ga0111539_123568111 120
39 3300009098 Ga0105245_10224430 Ga0105245_102244303 120
40 3300009098 Ga0105245_10247124 Ga0105245_102471243 120
41 3300009147 Ga0114129_12328507 Ga0114129_123285072 120
42 3300009174 Ga0105241_10240029 Ga0105241_102400292 120
43 3300009176 Ga0105242_10830747 Ga0105242_108307471 120
44 3300009545 Ga0105237_10000576 Ga0105237_1000057639 120
45 3300009551 Ga0105238_10001400 Ga0105238_1000140019 120
46 3300010375 Ga0105239_10224463 Ga0105239_102244632 120
47 3300013297 Ga0157378_10717621 Ga0157378_107176212 120
48 3300013297 Ga0157378_10764193 Ga0157378_107641931 120
49 3300013306 Ga0163162_10003551 Ga0163162_100035516 120
50 3300013308 Ga0157375_11216232 Ga0157375_112162322 120
51 3300014968 Ga0157379_10463969 Ga0157379_104639692 120
52 3300021358 Ga0213873_10000018 Ga0213873_10000018107 120
53 3300021384 Ga0213876_10000058 Ga0213876_10000058112 120
54 3300025910 Ga0207684_10164603 Ga0207684_101646032 120
55 3300025913 Ga0207695_10212190 Ga0207695_102121902 120
56 3300025914 Ga0207671_10000532 Ga0207671_100005327 120
57 3300025922 Ga0207646_10006894 Ga0207646_100068944 120
58 3300025924 Ga0207694_10016855 Ga0207694_100168555 120
59 3300025927 Ga0207687_10067194 Ga0207687_100671942 120
60 3300025936 Ga0207670_10010985 Ga0207670_100109856 120
61 3300025937 Ga0207669_10226935 Ga0207669_102269352 120
62 3300025960 Ga0207651_10923323 Ga0207651_109233232 120
63 3300025961 Ga0207712_11974290 Ga0207712_119742901 120
64 3300026041 Ga0207639_10000013 Ga0207639_1000001352 120
65 3300026088 Ga0207641_12616735 Ga0207641_126167351 120
66 3300026118 Ga0207675_100459937 Ga0207675_1004599372 120
67 3300027907 Ga0207428_10005293 Ga0207428_100052931 120
68 3300027907 Ga0207428_10017398 Ga0207428_100173983 120
69 3300031344 Ga0265316_10411139 Ga0265316_104111392 120
70 3300031727 Ga0316576_10375002 Ga0316576_103750022 120
71 3300031727 Ga0316576_10408502 Ga0316576_104085021 120
72 3300032133 Ga0316583_10005640 Ga0316583_100056401 120
73 3300035117 Ga0373953_0050866 Ga0373953_0050866_93_455 120
74 3300039437 Ga0436365_0337700 Ga0436365_0337700_7541_7903 120
75 3300039438 Ga0436360_0622357 Ga0436360_0622357_55_420 120
76 3300039453 Ga0436362_0011715 Ga0436362_0011715_10942_11304 120
77 3300039453 Ga0436362_0848683 Ga0436362_0848683_173_535 120
78 3300044712 Ga0453684_0014517 Ga0453684_0014517_3902_4270 120
79 3300044712 Ga0453684_0026426 Ga0453684_0026426_1404_1769 120
80 3300044712 Ga0453684_0107007 Ga0453684_0107007_1453_1815 120
81 3300044712 Ga0453684_0950126 Ga0453684_0950126_491_856 120
82 3300044712 Ga0453684_2214564 Ga0453684_2214564_79_444 120
83 3300045051 Ga0451576_0191246 Ga0451576_0191246_425_787 120
84 3300045051 Ga0451576_1563070 Ga0451576_1563070_52_417 120
85 3300046472 Ga0495580_0065483 Ga0495580_0065483_258_623 120
86 3300046529 Ga0495652_0869042 Ga0495652_0869042_21_386 120
87 3300046535 Ga0495586_0009164 Ga0495586_0009164_1937_2299 120
88 3300047322 Ga0495680_0207045 Ga0495680_0207045_668_1030 120
89 3300048088 Ga0495602_0123819 Ga0495602_0123819_920_1285 120
90 3300048913 Ga0496110_0961913 Ga0496110_0961913_290_652 120
91 3300049823 Ga0501044_0570349 Ga0501044_0570349_255_617 120
92 3300050511 nmdc:mga08y16_17702_c1 nmdc:mga08y16_17702_c1_2093_2518 120
93 3300050511 nmdc:mga08y16_602_c1 nmdc:mga08y16_602_c1_3373_3735 120
94 3300050512 nmdc:mga0n895_1719513_c1 nmdc:mga0n895_1719513_c1_61_423 120
95 3300050512 nmdc:mga0n895_235501_c1 nmdc:mga0n895_235501_c1_250_612 120
96 3300050513 nmdc:mga0rr50_1833_c1 nmdc:mga0rr50_1833_c1_9913_10278 120
97 3300050513 nmdc:mga0rr50_5213_c1 nmdc:mga0rr50_5213_c1_3517_3879 120
98 3300050513 nmdc:mga0rr50_86477_c1 nmdc:mga0rr50_86477_c1_603_965 120
99 3300006847 Ga0075431_100324231 Ga0075431_1003242313 121
100 3300006880 Ga0075429_100082186 Ga0075429_1000821862 121
101 3300009174 Ga0105241_10104424 Ga0105241_101044244 121
102 3300009545 Ga0105237_10083631 Ga0105237_100836315 121
103 3300010375 Ga0105239_10048009 Ga0105239_100480092 121
104 3300041452 Ga0451793_0286567 Ga0451793_0286567_67_432 121
105 3300050508 nmdc:mga09592_74817_c1 nmdc:mga09592_74817_c1_171_536 121
106 3300050510 nmdc:mga06r32_51460_c1 nmdc:mga06r32_51460_c1_2088_2453 121
107 3300021384 Ga0213876_10619495 Ga0213876_106194952 122
108 3300021388 Ga0213875_10074800 Ga0213875_100748004 122
109 3300037853 Ga0436364_0005241 Ga0436364_0005241_1951_2319 122
110 3300039062 Ga0400483_224996 Ga0400483_224996_1027_1413 122
111 3300039437 Ga0436365_1507494 Ga0436365_1507494_102_470 122
112 3300007076 Ga0075435_100129686 Ga0075435_1001296861 124
113 3300025939 Ga0207665_11010773 Ga0207665_110107732 124
114 3300025932 Ga0207690_10175254 Ga0207690_101752542 125
115 3300047471 Ga0495684_0196766 Ga0495684_0196766_764_1321 126
116 3300005329 Ga0070683_100654210 Ga0070683_1006542102 127
117 3300005535 Ga0070684_100116670 Ga0070684_1001166705 127
118 3300005563 Ga0068855_100233935 Ga0068855_1002339352 127
119 3300005577 Ga0068857_100049505 Ga0068857_1000495052 127
120 3300026041 Ga0207639_11259048 Ga0207639_112590482 127
121 3300026116 Ga0207674_10032284 Ga0207674_100322845 127

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vzy-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.9306 43 116
6vzy-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.9253 41 116
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.9088 25 115
6m9r-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.9079 41 117
1yhf-assembly1.cif.gz_A crystal structure of conserved spy1581 protein of unknown function from streptococcus pyogenes 0.9077 25 119
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9248 40 115 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9106 39 127 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9083 41 115 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8889 27 115 2.60.120.10
af_Q5A3Z5_62_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8864 39 117 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3B8YZF2-F1-model_v4 Cupin 0.9949 7 126
AF-A0A2V8UH96-F1-model_v4 Cupin 0.9938 17 127
AF-A0A2N1W3A6-F1-model_v4 Cupin 0.9892 8 127
AF-A0A2V2N7D5-F1-model_v4 N-acetyltransferase domain-containing protein 0.9874 7 127 GO:0016747
AF-A0A7K4B6E9-F1-model_v4 GNAT family N-acetyltransferase 0.986 7 127 GO:0016747

Feature Viewer

pLDDT pTM Quality
94.12 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map