F110177

General Info

Members Datasets Scaffolds Average Seq Length
121 99 242 202

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10331277|Ga0157372_103312772
Length 236
Sequence MIGPEIAQRHKETKSAKKLFCHSSFGLDSDFELRISDFPTMPDRKSQISRQTKETKVRLALDLDGSGKSAPHTGVGFFDHMLDLLARHSLIDLEVDAEGDLQVDAHHTVEDVGIVLGQALEQALGDNRGIHRYGWAIVPMDESLAQVAIDLSGRPAFVFKVSFAGESIGAFPTELVEEFFKALATNAKLNLHIHVPYGGNNHHIAEAIFKATAKALRQAVSLDPTNQDVPSTKGTL

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
78 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
91 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
92 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
93 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
94 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
95 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
96 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
97 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
98 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
99 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.96
Nodule 0
Rhizoplane 3.31
Rhizosphere 91.74
Stem 0
Stem Tuber 0
Unclassified 11.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10331277 3300013307 Bacteria 1773
2 Ga0070658_10005748 3300005327 Bacteria 10060
3 Ga0070691_10217661 3300005341 Bacteria 1011
4 Ga0070661_100668375 3300005344 Bacteria 844
5 Ga0070675_100281141 3300005354 Bacteria 1462
6 Ga0070671_100242283 3300005355 Bacteria 1531
7 Ga0070671_100256463 3300005355 Bacteria 1486
8 Ga0070674_100351249 3300005356 Bacteria 1191
9 Ga0070673_100034218 3300005364 Bacteria 3842
10 Ga0070673_100291531 3300005364 Bacteria 1434
11 Ga0070659_101061952 3300005366 Bacteria 713
12 Ga0070714_100439375 3300005435 Unclassified 1238
13 Ga0070714_101146838 3300005435 Bacteria 758
14 Ga0070713_100041925 3300005436 Bacteria 3732
15 Ga0070708_100100802 3300005445 Bacteria 2644
16 Ga0070678_100364589 3300005456 Bacteria 1246
17 Ga0070706_100006443 3300005467 Bacteria 11081
18 Ga0070698_100181711 3300005471 Bacteria 2042
19 Ga0070665_100148404 3300005548 Bacteria 2347
20 Ga0070704_100171153 3300005549 Unclassified 1727
21 Ga0070664_100333011 3300005564 Bacteria 1377
22 Ga0081539_10014933 3300005985 Bacteria 5698
23 Ga0070717_10051671 3300006028 Bacteria 3384
24 Ga0075363_100006060 3300006048 Bacteria 5453
25 Ga0075362_10010074 3300006177 Bacteria 3678
26 Ga0075367_10083446 3300006178 Unclassified 1936
27 Ga0075430_100176960 3300006846 Bacteria 1775
28 Ga0075434_100697657 3300006871 Bacteria 1032
29 Ga0075434_100898797 3300006871 Bacteria 900
30 Ga0075436_100332015 3300006914 Unclassified 1094
31 Ga0075435_100343059 3300007076 Archaea 1280
32 Ga0099794_10178576 3300007265 Bacteria 1083
33 Ga0105240_10010902 3300009093 Bacteria 12735
34 Ga0105247_10177237 3300009101 Bacteria 1421
35 Ga0114129_10822946 3300009147 Bacteria 1183
36 Ga0105248_10492250 3300009177 Bacteria 1382
37 Ga0105249_10193035 3300009553 Bacteria 1988
38 Ga0157371_10359485 3300013102 Bacteria 1061
39 Ga0157370_10549047 3300013104 Bacteria 1059
40 Ga0157370_10550478 3300013104 Bacteria 1058
41 Ga0157369_10440867 3300013105 Bacteria 1349
42 Ga0157369_10520772 3300013105 Unclassified 1230
43 Ga0157369_11013121 3300013105 Bacteria 850
44 Ga0157369_11449185 3300013105 Bacteria 699
45 Ga0157374_10294518 3300013296 Bacteria 1604
46 Ga0157378_11428124 3300013297 Bacteria 735
47 Ga0163162_10594200 3300013306 Bacteria 1233
48 Ga0157372_10404029 3300013307 Bacteria 1592
49 Ga0163163_10838311 3300014325 Bacteria 983
50 Ga0163163_11173757 3300014325 Bacteria 830
51 Ga0182008_10433134 3300014497 Bacteria 712
52 Ga0207653_10000005 3300025885 Bacteria 257928
53 Ga0207688_10431856 3300025901 Bacteria 819
54 Ga0207680_10067620 3300025903 Bacteria 2202
55 Ga0207705_10004843 3300025909 Bacteria 10121
56 Ga0207695_10000126 3300025913 Bacteria 228511
57 Ga0207660_10186565 3300025917 Bacteria 1613
58 Ga0207649_10081466 3300025920 Bacteria 2096
59 Ga0207649_10103386 3300025920 Unclassified 1890
60 Ga0207650_10007967 3300025925 Bacteria 7222
61 Ga0207659_10100663 3300025926 Bacteria 2178
62 Ga0207659_10207410 3300025926 Bacteria 1569
63 Ga0207687_10041593 3300025927 Bacteria 3157
64 Ga0207700_10079993 3300025928 Bacteria 2547
65 Ga0207700_10231896 3300025928 Unclassified 1570
66 Ga0207664_10662425 3300025929 Unclassified 938
67 Ga0207644_10005027 3300025931 Bacteria 8634
68 Ga0207670_10052483 3300025936 Bacteria 2742
69 Ga0207691_10556371 3300025940 Bacteria 972
70 Ga0207679_10110177 3300025945 Bacteria 2171
71 Ga0207667_10333378 3300025949 Bacteria 1549
72 Ga0207651_10016951 3300025960 Bacteria 4288
73 Ga0207651_10622152 3300025960 Bacteria 946
74 Ga0207651_10882814 3300025960 Bacteria 796
75 Ga0207676_10449314 3300026095 Bacteria 1215
76 Ga0268266_10084429 3300028379 Bacteria 2773
77 Ga0316575_10198208 3300031665 Bacteria 836
78 Ga0307405_10160094 3300031731 Bacteria 1593
79 Ga0307413_10254601 3300031824 Bacteria 1305
80 Ga0307410_10591147 3300031852 Bacteria 925
81 Ga0307412_10021741 3300031911 Archaea 3923
82 Ga0307409_100054486 3300031995 Bacteria 3080
83 Ga0307409_100678126 3300031995 Bacteria 1028
84 Ga0373923_0166315 3300035111 Bacteria 1008
85 Ga0373936_0017008 3300035113 Bacteria 2797
86 Ga0316574_0061807 3300035398 Bacteria 2353
87 Ga0395899_0385347 3300037312 Bacteria 931
88 Ga0395901_0283077 3300038443 Bacteria 1722
89 Ga0451577_0119316 3300042876 Bacteria 2362
90 Ga0453684_0162193 3300044712 Bacteria 2643
91 Ga0495629_0341663 3300046459 Bacteria 1022
92 Ga0495662_0151816 3300046476 Bacteria 1141
93 Ga0495640_0099096 3300046533 Unclassified 1915
94 Ga0495645_0137474 3300046543 Bacteria 1708
95 Ga0495613_0001867 3300046689 Bacteria 16006
96 Ga0495613_0048350 3300046689 Bacteria 3141
97 Ga0495680_0105260 3300047322 Bacteria 2098
98 Ga0495684_0002675 3300047471 Bacteria 14122
99 Ga0495684_0289738 3300047471 Unclassified 1179
100 Ga0495684_0336623 3300047471 Bacteria 1075
101 Ga0496101_0067877 3300048904 Bacteria 2605
102 Ga0496102_0088819 3300048905 Bacteria 2858
103 Ga0496111_0312333 3300048914 Bacteria 1165
104 Ga0496112_0116807 3300048915 Bacteria 2638
105 Ga0501034_0000450 3300049571 Bacteria 68026
106 Ga0501047_0008419 3300049581 Bacteria 9731
107 Ga0501080_0157114 3300049742 Unclassified 2100
108 Ga0501044_0001383 3300049823 Bacteria 28449
109 Ga0501044_0023549 3300049823 Bacteria 6550
110 Ga0501044_0565448 3300049823 Bacteria 1033
111 nmdc:mga03683_18427_c1 3300050489 Bacteria 2654
112 nmdc:mga03n38_2734_c1 3300050490 Bacteria 5522
113 nmdc:mga06z11_61771_c1 3300050494 Unclassified 1955
114 nmdc:mga0qj67_171196_c1 3300050509 Bacteria 1763
115 nmdc:mga06r32_542745_c1 3300050510 Bacteria 1137
116 nmdc:mga0n895_812801_c1 3300050512 Bacteria 925
117 nmdc:mga0n895_82526_c1 3300050512 Bacteria 3205
118 nmdc:mga08x19_240645_c1 3300050514 Bacteria 1247
119 nmdc:mga0a205_495537_c1 3300050515 Unclassified 1079
120 Ga0495595_0383976 3300053084 Bacteria 711
121 Ga0501082_0204199 3300060353 Unclassified 1719
122 Ga0157372_10331277
123 Ga0070658_10005748
124 Ga0070691_10217661
125 Ga0070661_100668375
126 Ga0070675_100281141
127 Ga0070671_100242283
128 Ga0070671_100256463
129 Ga0070674_100351249
130 Ga0070673_100034218
131 Ga0070673_100291531
132 Ga0070659_101061952
133 Ga0070714_100439375
134 Ga0070714_101146838
135 Ga0070713_100041925
136 Ga0070708_100100802
137 Ga0070678_100364589
138 Ga0070706_100006443
139 Ga0070698_100181711
140 Ga0070665_100148404
141 Ga0070704_100171153
142 Ga0070664_100333011
143 Ga0081539_10014933
144 Ga0070717_10051671
145 Ga0075363_100006060
146 Ga0075362_10010074
147 Ga0075367_10083446
148 Ga0075430_100176960
149 Ga0075434_100697657
150 Ga0075434_100898797
151 Ga0075436_100332015
152 Ga0075435_100343059
153 Ga0099794_10178576
154 Ga0105240_10010902
155 Ga0105247_10177237
156 Ga0114129_10822946
157 Ga0105248_10492250
158 Ga0105249_10193035
159 Ga0157371_10359485
160 Ga0157370_10549047
161 Ga0157370_10550478
162 Ga0157369_10440867
163 Ga0157369_10520772
164 Ga0157369_11013121
165 Ga0157369_11449185
166 Ga0157374_10294518
167 Ga0157378_11428124
168 Ga0163162_10594200
169 Ga0157372_10404029
170 Ga0163163_10838311
171 Ga0163163_11173757
172 Ga0182008_10433134
173 Ga0207653_10000005
174 Ga0207688_10431856
175 Ga0207680_10067620
176 Ga0207705_10004843
177 Ga0207695_10000126
178 Ga0207660_10186565
179 Ga0207649_10081466
180 Ga0207649_10103386
181 Ga0207650_10007967
182 Ga0207659_10100663
183 Ga0207659_10207410
184 Ga0207687_10041593
185 Ga0207700_10079993
186 Ga0207700_10231896
187 Ga0207664_10662425
188 Ga0207644_10005027
189 Ga0207670_10052483
190 Ga0207691_10556371
191 Ga0207679_10110177
192 Ga0207667_10333378
193 Ga0207651_10016951
194 Ga0207651_10622152
195 Ga0207651_10882814
196 Ga0207676_10449314
197 Ga0268266_10084429
198 Ga0316575_10198208
199 Ga0307405_10160094
200 Ga0307413_10254601
201 Ga0307410_10591147
202 Ga0307412_10021741
203 Ga0307409_100054486
204 Ga0307409_100678126
205 Ga0373923_0166315
206 Ga0373936_0017008
207 Ga0316574_0061807
208 Ga0395899_0385347
209 Ga0395901_0283077
210 Ga0451577_0119316
211 Ga0453684_0162193
212 Ga0495629_0341663
213 Ga0495662_0151816
214 Ga0495640_0099096
215 Ga0495645_0137474
216 Ga0495613_0001867
217 Ga0495613_0048350
218 Ga0495680_0105260
219 Ga0495684_0002675
220 Ga0495684_0289738
221 Ga0495684_0336623
222 Ga0496101_0067877
223 Ga0496102_0088819
224 Ga0496111_0312333
225 Ga0496112_0116807
226 Ga0501034_0000450
227 Ga0501047_0008419
228 Ga0501080_0157114
229 Ga0501044_0001383
230 Ga0501044_0023549
231 Ga0501044_0565448
232 nmdc:mga03683_18427_c1
233 nmdc:mga03n38_2734_c1
234 nmdc:mga06z11_61771_c1
235 nmdc:mga0qj67_171196_c1
236 nmdc:mga06r32_542745_c1
237 nmdc:mga0n895_812801_c1
238 nmdc:mga0n895_82526_c1
239 nmdc:mga08x19_240645_c1
240 nmdc:mga0a205_495537_c1
241 Ga0495595_0383976
242 Ga0501082_0204199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

73

216

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9883 3 184
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9848 1 184
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9837 1 185
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9776 3 184
4mu4-assembly1.cif.gz_A the form b structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and its substrate, 2r3s-igp, to 1.41 a resolution 0.9775 1 194
ID Description Score Start End Superfamily
af_C6T988_68_169_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9919 2 89 3.30.230.40
2ae8A02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9858 91 175 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9801 1 89 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9786 91 184 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9685 91 184 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A522GSK4-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 1.007 4 78 GO:0000105
GO:0004424
AF-A0A355VD00-F1-model_v4 deleted 1.006 4 70
AF-A0A349UMK4-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 1.006 1 67 GO:0000105
GO:0004424
AF-A0A3D0LTM6-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 1.006 4 71 GO:0000105
GO:0004424
AF-A0A2E0YIT5-F1-model_v4 deleted 1.006 4 63

Map