F109399

General Info

Members Datasets Scaffolds Average Seq Length
121 97 120 138

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100160082|Ga0070696_1001600822
Length 148
Sequence VASATGVAVPGCYTWAKPVPVTYKIGNVLDLDAVIELYRASTLGERRPIEERERMAKMLENANLVITAWDGDLLVGISRSFTDFAYVTYLADLAVRESHQRQGIGKELIRRTQLACGPQTKIVLLAAPKAVDYYPHIGFTHHPQAWVL

Samples

Sample ID Description Type Environment
1 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
58 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
59 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
60 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
61 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
66 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
71 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
72 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
73 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
74 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
75 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
78 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
79 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
80 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
83 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
84 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
85 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
86 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
87 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
90 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
93 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
94 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
95 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
96 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
97 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 0
Rhizosphere 97.52
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10091557 3300003320 Bacteria 6786
2 Ga0070690_100811693 3300005330 Bacteria 726
3 Ga0070670_100355389 3300005331 Bacteria 1288
4 Ga0068869_101655874 3300005334 Bacteria 570
5 Ga0070666_10953799 3300005335 Bacteria 635
6 Ga0070689_100182363 3300005340 Bacteria 1706
7 Ga0070689_100835940 3300005340 Unclassified 811
8 Ga0070675_100182259 3300005354 Bacteria 1816
9 Ga0070688_100466665 3300005365 Unclassified 947
10 Ga0070688_100554743 3300005365 Unclassified 874
11 Ga0070688_100653108 3300005365 Bacteria 810
12 Ga0070688_100756943 3300005365 Unclassified 757
13 Ga0070711_100310957 3300005439 Unclassified 1256
14 Ga0070705_100065573 3300005440 Bacteria 2174
15 Ga0068867_100814034 3300005459 Bacteria 834
16 Ga0070707_100112078 3300005468 Unclassified 2646
17 Ga0070698_100010675 3300005471 Bacteria 9785
18 Ga0070698_100208250 3300005471 Unclassified 1891
19 Ga0070697_100402267 3300005536 Archaea 1188
20 Ga0070686_101823112 3300005544 Unclassified 518
21 Ga0070696_100160082 3300005546 Unclassified 1658
22 Ga0070704_100237164 3300005549 Unclassified 1491
23 Ga0070664_100856201 3300005564 Bacteria 851
24 Ga0070702_100390118 3300005615 Bacteria 993
25 Ga0068864_100669036 3300005618 Bacteria 1012
26 Ga0068863_100418088 3300005841 Bacteria 1313
27 Ga0068863_100595068 3300005841 Unclassified 1094
28 Ga0068862_101039023 3300005844 Bacteria 812
29 Ga0070716_100730974 3300006173 Unclassified 759
30 Ga0097621_100320513 3300006237 Bacteria 1373
31 Ga0097621_100827270 3300006237 Bacteria 859
32 Ga0068871_100951651 3300006358 Unclassified 798
33 Ga0075428_101251337 3300006844 Bacteria 781
34 Ga0075430_100074407 3300006846 Bacteria 2848
35 Ga0075431_100129179 3300006847 Bacteria 2607
36 Ga0075429_101297539 3300006880 Bacteria 635
37 Ga0075435_100670838 3300007076 Unclassified 900
38 Ga0099794_10579287 3300007265 Bacteria 594
39 Ga0105240_10575636 3300009093 Unclassified 1243
40 Ga0111539_10091723 3300009094 Bacteria 3569
41 Ga0111539_12062654 3300009094 Unclassified 661
42 Ga0114129_11213581 3300009147 Unclassified 939
43 Ga0114129_12631086 3300009147 Unclassified 600
44 Ga0105248_11071377 3300009177 Bacteria 911
45 Ga0105238_10966243 3300009551 Unclassified 872
46 Ga0099796_10274993 3300010159 Unclassified 706
47 Ga0157370_10630971 3300013104 Unclassified 980
48 Ga0163162_10285845 3300013306 Bacteria 1781
49 Ga0157375_13640566 3300013308 Unclassified 512
50 Ga0163163_10317603 3300014325 Bacteria 1611
51 Ga0163163_11709718 3300014325 Bacteria 690
52 Ga0157380_10132291 3300014326 Unclassified 2130
53 Ga0207695_10305598 3300025913 Bacteria 1481
54 Ga0207646_10100405 3300025922 Unclassified 2594
55 Ga0207694_10555621 3300025924 Unclassified 964
56 Ga0207650_10099628 3300025925 Bacteria 2234
57 Ga0207650_10112611 3300025925 Bacteria 2109
58 Ga0207670_10093795 3300025936 Bacteria 2128
59 Ga0207670_10337205 3300025936 Unclassified 1190
60 Ga0207679_11102144 3300025945 Bacteria 728
61 Ga0207703_11039069 3300026035 Unclassified 786
62 Ga0207641_10294053 3300026088 Bacteria 1532
63 Ga0207641_10581047 3300026088 Unclassified 1095
64 Ga0207648_11331642 3300026089 Unclassified 675
65 Ga0207674_11508345 3300026116 Unclassified 641
66 Ga0268265_10205808 3300028380 Bacteria 1711
67 Ga0268265_10482058 3300028380 Unclassified 1165
68 Ga0265314_10002931 3300031711 Bacteria 16933
69 Ga0307415_100104246 3300032126 Unclassified 2089
70 Ga0373926_0078917 3300035083 Unclassified 1215
71 Ga0373936_0485531 3300035113 Bacteria 574
72 Ga0373960_0312634 3300035121 Bacteria 587
73 Ga0373961_0417064 3300035241 Unclassified 518
74 Ga0373927_0007745 3300035695 Bacteria 7264
75 Ga0373937_0668102 3300036401 Unclassified 985
76 Ga0373925_0681697 3300037068 Bacteria 847
77 Ga0373925_1282766 3300037068 Unclassified 601
78 Ga0436365_1069490 3300039437 Bacteria 3634
79 Ga0451577_0004798 3300042876 Bacteria 14125
80 Ga0451577_1213813 3300042876 Unclassified 672
81 Ga0453683_0817984 3300044673 Unclassified 614
82 Ga0453684_0020196 3300044712 Bacteria 10073
83 Ga0453684_0878344 3300044712 Bacteria 962
84 Ga0451576_0244226 3300045051 Bacteria 1876
85 Ga0451576_0330960 3300045051 Bacteria 1594
86 Ga0495592_0679642 3300046454 Bacteria 621
87 Ga0495580_0218128 3300046472 Unclassified 1311
88 Ga0495594_0274197 3300046499 Bacteria 961
89 Ga0495586_0180693 3300046535 Bacteria 1193
90 Ga0495645_0139165 3300046543 Bacteria 1695
91 Ga0495599_0082174 3300046678 Bacteria 2013
92 Ga0495658_0257286 3300046683 Bacteria 1099
93 Ga0495613_0298620 3300046689 Bacteria 1115
94 Ga0495613_0609113 3300046689 Unclassified 726
95 Ga0495680_0256431 3300047322 Bacteria 1238
96 Ga0495684_0922039 3300047471 Unclassified 561
97 Ga0495602_0808404 3300048088 Unclassified 629
98 Ga0501032_0571690 3300049569 Bacteria 720
99 Ga0501038_1318322 3300049574 Archaea 521
100 Ga0501067_0010604 3300049583 Bacteria 5099
101 Ga0501068_0191480 3300049584 Bacteria 1295
102 Ga0501073_0138742 3300049589 Bacteria 1685
103 Ga0501075_0000261 3300049591 Bacteria 28643
104 Ga0501075_1290050 3300049591 Unclassified 553
105 Ga0501077_0001799 3300049593 Bacteria 12964
106 Ga0501079_0429768 3300049741 Bacteria 1037
107 Ga0501080_0002226 3300049742 Bacteria 16864
108 Ga0501080_0373367 3300049742 Bacteria 1286
109 nmdc:mga09592_1341397_c1 3300050508 Bacteria 587
110 nmdc:mga0qj67_14665_c1 3300050509 Bacteria 5925
111 nmdc:mga0qj67_55997_c1 3300050509 Bacteria 3125
112 nmdc:mga06r32_180037_c1 3300050510 Bacteria 2099
113 nmdc:mga06r32_95336_c1 3300050510 Bacteria 2912
114 nmdc:mga08y16_1394387_c1 3300050511 Unclassified 664
115 nmdc:mga08y16_393553_c1 3300050511 Unclassified 1419
116 nmdc:mga0rr50_750475_c1 3300050513 Unclassified 833
117 Ga0495601_0720529 3300053077 Bacteria 636
118 Ga0495612_0121131 3300053078 Bacteria 1125
119 Ga0500556_0017443 3300053104 Bacteria 2250
120 Ga0501082_0002724 3300060353 Bacteria 15433

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005564 Ga0070664_100856201 Ga0070664_1008562012 117
2 3300005618 Ga0068864_100669036 Ga0068864_1006690362 117
3 3300025945 Ga0207679_11102144 Ga0207679_111021442 117
4 3300005536 Ga0070697_100402267 Ga0070697_1004022672 119
5 3300005544 Ga0070686_101823112 Ga0070686_1018231121 121
6 3300005334 Ga0068869_101655874 Ga0068869_1016558741 128
7 3300005546 Ga0070696_100160082 Ga0070696_1001600822 128
8 3300035695 Ga0373927_0007745 Ga0373927_0007745_478_867 128
9 3300046472 Ga0495580_0218128 Ga0495580_0218128_512_901 128
10 3300006358 Ga0068871_100951651 Ga0068871_1009516512 129
11 3300053104 Ga0500556_0017443 Ga0500556_0017443_763_1164 131
12 3300006846 Ga0075430_100074407 Ga0075430_1000744074 133
13 3300006847 Ga0075431_100129179 Ga0075431_1001291791 133
14 3300006880 Ga0075429_101297539 Ga0075429_1012975391 133
15 3300007265 Ga0099794_10579287 Ga0099794_105792871 133
16 3300037068 Ga0373925_0681697 Ga0373925_0681697_385_789 133
17 3300037068 Ga0373925_1282766 Ga0373925_1282766_54_458 133
18 3300049589 Ga0501073_0138742 Ga0501073_0138742_155_562 133
19 3300050508 nmdc:mga09592_1341397_c1 nmdc:mga09592_1341397_c1_93_497 133
20 3300050509 nmdc:mga0qj67_55997_c1 nmdc:mga0qj67_55997_c1_731_1135 133
21 3300050510 nmdc:mga06r32_180037_c1 nmdc:mga06r32_180037_c1_1591_1995 133
22 3300006844 Ga0075428_101251337 Ga0075428_1012513372 134
23 3300009147 Ga0114129_11213581 Ga0114129_112135812 134
24 3300035083 Ga0373926_0078917 Ga0373926_0078917_51_458 134
25 3300036401 Ga0373937_0668102 Ga0373937_0668102_524_949 134
26 3300050509 nmdc:mga0qj67_14665_c1 nmdc:mga0qj67_14665_c1_1219_1641 134
27 3300050510 nmdc:mga06r32_95336_c1 nmdc:mga06r32_95336_c1_1618_2040 134
28 3300003320 rootH2_10091557 rootH2_100915573 135
29 3300005330 Ga0070690_100811693 Ga0070690_1008116931 135
30 3300005331 Ga0070670_100355389 Ga0070670_1003553892 135
31 3300005335 Ga0070666_10953799 Ga0070666_109537991 135
32 3300005340 Ga0070689_100182363 Ga0070689_1001823631 135
33 3300005340 Ga0070689_100835940 Ga0070689_1008359401 135
34 3300005354 Ga0070675_100182259 Ga0070675_1001822592 135
35 3300005365 Ga0070688_100466665 Ga0070688_1004666651 135
36 3300005365 Ga0070688_100554743 Ga0070688_1005547431 135
37 3300005365 Ga0070688_100653108 Ga0070688_1006531082 135
38 3300005365 Ga0070688_100756943 Ga0070688_1007569432 135
39 3300005439 Ga0070711_100310957 Ga0070711_1003109572 135
40 3300005440 Ga0070705_100065573 Ga0070705_1000655733 135
41 3300005459 Ga0068867_100814034 Ga0068867_1008140342 135
42 3300005468 Ga0070707_100112078 Ga0070707_1001120783 135
43 3300005471 Ga0070698_100010675 Ga0070698_1000106758 135
44 3300005471 Ga0070698_100208250 Ga0070698_1002082503 135
45 3300005549 Ga0070704_100237164 Ga0070704_1002371642 135
46 3300005615 Ga0070702_100390118 Ga0070702_1003901182 135
47 3300005841 Ga0068863_100418088 Ga0068863_1004180882 135
48 3300005841 Ga0068863_100595068 Ga0068863_1005950682 135
49 3300005844 Ga0068862_101039023 Ga0068862_1010390232 135
50 3300006173 Ga0070716_100730974 Ga0070716_1007309742 135
51 3300006237 Ga0097621_100320513 Ga0097621_1003205132 135
52 3300006237 Ga0097621_100827270 Ga0097621_1008272702 135
53 3300007076 Ga0075435_100670838 Ga0075435_1006708382 135
54 3300009093 Ga0105240_10575636 Ga0105240_105756361 135
55 3300009094 Ga0111539_10091723 Ga0111539_100917232 135
56 3300009094 Ga0111539_12062654 Ga0111539_120626541 135
57 3300009147 Ga0114129_12631086 Ga0114129_126310861 135
58 3300009177 Ga0105248_11071377 Ga0105248_110713772 135
59 3300009551 Ga0105238_10966243 Ga0105238_109662432 135
60 3300010159 Ga0099796_10274993 Ga0099796_102749931 135
61 3300013104 Ga0157370_10630971 Ga0157370_106309711 135
62 3300013306 Ga0163162_10285845 Ga0163162_102858452 135
63 3300013308 Ga0157375_13640566 Ga0157375_136405661 135
64 3300014325 Ga0163163_10317603 Ga0163163_103176032 135
65 3300014325 Ga0163163_11709718 Ga0163163_117097181 135
66 3300014326 Ga0157380_10132291 Ga0157380_101322912 135
67 3300025913 Ga0207695_10305598 Ga0207695_103055982 135
68 3300025922 Ga0207646_10100405 Ga0207646_101004053 135
69 3300025924 Ga0207694_10555621 Ga0207694_105556212 135
70 3300025925 Ga0207650_10099628 Ga0207650_100996284 135
71 3300025925 Ga0207650_10112611 Ga0207650_101126113 135
72 3300025936 Ga0207670_10093795 Ga0207670_100937952 135
73 3300025936 Ga0207670_10337205 Ga0207670_103372052 135
74 3300026035 Ga0207703_11039069 Ga0207703_110390691 135
75 3300026088 Ga0207641_10294053 Ga0207641_102940532 135
76 3300026088 Ga0207641_10581047 Ga0207641_105810472 135
77 3300026089 Ga0207648_11331642 Ga0207648_113316422 135
78 3300026116 Ga0207674_11508345 Ga0207674_115083452 135
79 3300028380 Ga0268265_10205808 Ga0268265_102058082 135
80 3300028380 Ga0268265_10482058 Ga0268265_104820582 135
81 3300031711 Ga0265314_10002931 Ga0265314_100029318 135
82 3300032126 Ga0307415_100104246 Ga0307415_1001042462 135
83 3300035113 Ga0373936_0485531 Ga0373936_0485531_24_434 135
84 3300035121 Ga0373960_0312634 Ga0373960_0312634_101_511 135
85 3300035241 Ga0373961_0417064 Ga0373961_0417064_87_497 135
86 3300039437 Ga0436365_1069490 Ga0436365_1069490_2408_2818 135
87 3300042876 Ga0451577_0004798 Ga0451577_0004798_5578_6009 135
88 3300042876 Ga0451577_1213813 Ga0451577_1213813_86_496 135
89 3300044673 Ga0453683_0817984 Ga0453683_0817984_140_550 135
90 3300044712 Ga0453684_0020196 Ga0453684_0020196_3994_4425 135
91 3300044712 Ga0453684_0878344 Ga0453684_0878344_271_681 135
92 3300045051 Ga0451576_0244226 Ga0451576_0244226_1119_1550 135
93 3300045051 Ga0451576_0330960 Ga0451576_0330960_829_1242 135
94 3300046454 Ga0495592_0679642 Ga0495592_0679642_157_567 135
95 3300046499 Ga0495594_0274197 Ga0495594_0274197_58_489 135
96 3300046535 Ga0495586_0180693 Ga0495586_0180693_630_1037 135
97 3300046543 Ga0495645_0139165 Ga0495645_0139165_533_943 135
98 3300046678 Ga0495599_0082174 Ga0495599_0082174_106_516 135
99 3300046683 Ga0495658_0257286 Ga0495658_0257286_324_734 135
100 3300046689 Ga0495613_0298620 Ga0495613_0298620_544_975 135
101 3300046689 Ga0495613_0609113 Ga0495613_0609113_177_599 135
102 3300047322 Ga0495680_0256431 Ga0495680_0256431_109_519 135
103 3300047471 Ga0495684_0922039 Ga0495684_0922039_42_473 135
104 3300048088 Ga0495602_0808404 Ga0495602_0808404_43_468 135
105 3300049569 Ga0501032_0571690 Ga0501032_0571690_229_642 135
106 3300049574 Ga0501038_1318322 Ga0501038_1318322_85_501 135
107 3300049583 Ga0501067_0010604 Ga0501067_0010604_1503_1931 135
108 3300049584 Ga0501068_0191480 Ga0501068_0191480_387_806 135
109 3300049591 Ga0501075_0000261 Ga0501075_0000261_1950_2369 135
110 3300049591 Ga0501075_1290050 Ga0501075_1290050_59_481 135
111 3300049593 Ga0501077_0001799 Ga0501077_0001799_1309_1728 135
112 3300049741 Ga0501079_0429768 Ga0501079_0429768_593_1015 135
113 3300049742 Ga0501080_0002226 Ga0501080_0002226_16153_16572 135
114 3300049742 Ga0501080_0373367 Ga0501080_0373367_428_850 135
115 3300050511 nmdc:mga08y16_1394387_c1 nmdc:mga08y16_1394387_c1_222_653 135
116 3300050511 nmdc:mga08y16_393553_c1 nmdc:mga08y16_393553_c1_818_1228 135
117 3300050513 nmdc:mga0rr50_750475_c1 nmdc:mga0rr50_750475_c1_237_647 135
118 3300053077 Ga0495601_0720529 Ga0495601_0720529_100_510 135
119 3300053078 Ga0495612_0121131 Ga0495612_0121131_220_630 135
120 3300060353 Ga0501082_0002724 Ga0501082_0002724_3268_3687 135
121 iso_pu_bacteria 2910245624 2910250975 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

39

145

0.87

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

61

141

0.73

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

31

139

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8739 43 129
7ypu-assembly1.cif.gz_A orfe-coa-glycylthricin complex 0.8695 45 120
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8671 43 129
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8669 43 129
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.859 45 120
ID Description Score Start End Superfamily
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8949 55 95 3.40.630.30
af_A0A0R0KKK3_57_216_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8552 1 122 3.40.630.30
af_Q6ES10_187_273_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8419 54 95 3.40.630.30
af_Q4DNW4_5_161_2.60.40.1490 Mainly Beta;Sandwich;Immunoglobulin-like;Histone chaperone ASF1-like 0.8382 45 61 2.60.40.1490
af_Q3Y3Z9_160_298_3.40.630.90 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.8275 1 97 3.40.630.90
ID Description Score Start End GO Terms
AF-A0A836PC52-F1-model_v4 deleted 0.9828 1 81
AF-A0A0E2GJY1-F1-model_v4 deleted 0.9811 1 89
AF-A0A350UKY7-F1-model_v4 GNAT family N-acetyltransferase 0.9779 1 82 GO:0016740
AF-A0A813A3D5-F1-model_v4 deleted 0.9696 1 122
AF-A0A6I5L445-F1-model_v4 GNAT family N-acetyltransferase 0.9689 1 123 GO:0016747

Feature Viewer

pLDDT pTM Quality
93.09 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map