F106114

General Info

Members Datasets Scaffolds Average Seq Length
120 97 56 140

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1157105|Ga0209025_11571051
Length 167
Sequence MGFIIDIKQFIIDNHTSISDFKVGGTRMTIQNINHLLFSVSNLEKSIAFYEKIFDAKLLVKGRSTAYFDVNGLWLALNVEEDIPRNEIHQSYTHVAFSIHEDNFDKMYEKLIQHNVNILEGRQRDVRDKKSIYFTDPDGHKFEFHTGTLRDRLNYYKKEKTHMEFFD

Samples

Sample ID Description Type Environment
1 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
2 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
3 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
4 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
5 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
6 2643221729 Bacillus sp. Root11 Isolate Unclassified
7 2643221730 Bacillus sp. Root131 Isolate Unclassified
8 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
9 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
10 2738543017 Bacillus sp. OV186 Isolate Unclassified
11 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
12 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
13 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
14 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
15 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
16 2811994870 Bacillus sp. JB4 Isolate Unclassified
17 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
18 2818991441 Niallia circulans 3243 Isolate Rhizosphere
19 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
20 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
21 2842682962 Bacillus sp. R-72492 Isolate Unclassified
22 2849139964 Bacillus sp. R-71875 Isolate Unclassified
23 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
24 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
25 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
26 2857586860 Bacillus sp. R-71935 Isolate Unclassified
27 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
28 2860837431 Bacillus sp. WR11 Isolate Unclassified
29 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
30 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
31 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
32 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
33 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
34 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
35 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
36 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
37 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
38 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
39 2938917290 Bacillus sp. CR71 Isolate Unclassified
40 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
41 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
42 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
43 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
44 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
45 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
46 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
47 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
48 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
49 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
50 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
51 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
52 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
53 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
54 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
55 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
56 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
57 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
58 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
62 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
63 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
64 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
65 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027200 Rhizosphere microbial communities from Harvard Forest, USA - 4Rhizosphere_NRpos metaG (SPAdes) Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
84 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
85 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
86 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
87 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 8022653035 Bacillus sp. Rc4 Isolate Unclassified
93 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
94 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
95 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
96 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
97 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 46.67
Metatranscriptomes 0
Isolates 53.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.83
Nodule 0
Rhizoplane 4.17
Rhizosphere 36.67
Stem 0
Stem Tuber 0
Unclassified 28.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1006855 3300002987 Bacteria 3344
2 JGI25151J46595_10010651 3300003187 Bacteria 4258
3 JGI25151J46595_10010947 3300003187 Bacteria 4193
4 JGI25151J46595_10018672 3300003187 Bacteria 2968
5 JGI25151J46595_10024262 3300003187 Bacteria 2483
6 JGI25151J46595_10028205 3300003187 Bacteria 2238
7 JGI25151J46595_10053313 3300003187 Bacteria 1352
8 Ga0055538_1000142 3300003751 Bacteria 50402
9 Ga0055532_1000088 3300003758 Bacteria 106291
10 Ga0055535_1008292 3300003761 Bacteria 1891
11 Ga0055536_1017828 3300003781 Bacteria 2304
12 Ga0055541_1001261 3300003841 Bacteria 5580
13 Ga0055541_1001600 3300003841 Bacteria 4853
14 Ga0105244_10005927 3300009036 Bacteria 8016
15 Ga0105244_10118890 3300009036 Bacteria 1281
16 Ga0105250_10118370 3300009092 Bacteria 1088
17 Ga0157371_10083310 3300013102 Bacteria 2264
18 Ga0209784_100129 3300025224 Bacteria 76203
19 Ga0209566_100029 3300025225 Bacteria 349213
20 Ga0209566_100067 3300025225 Bacteria 180297
21 Ga0209566_100676 3300025225 Bacteria 20192
22 Ga0209147_100045 3300025229 Bacteria 299264
23 Ga0209147_100058 3300025229 Bacteria 252750
24 Ga0209258_101566 3300025242 Bacteria 7625
25 Ga0209130_1000713 3300025284 Bacteria 29522
26 Ga0209130_1014996 3300025284 Bacteria 1925
27 Ga0209675_1041727 3300025291 Bacteria 999
28 Ga0209676_1000530 3300025292 Bacteria 59517
29 Ga0209676_1000574 3300025292 Bacteria 55392
30 Ga0209676_1012244 3300025292 Bacteria 3389
31 Ga0209676_1045089 3300025292 Bacteria 1203
32 Ga0209025_1000703 3300025294 Bacteria 56965
33 Ga0209025_1000801 3300025294 Bacteria 51045
34 Ga0209025_1001603 3300025294 Bacteria 28424
35 Ga0209025_1003715 3300025294 Bacteria 14034
36 Ga0209025_1006833 3300025294 Bacteria 8709
37 Ga0209025_1014523 3300025294 Bacteria 4832
38 Ga0209025_1014866 3300025294 Bacteria 4745
39 Ga0209025_1025794 3300025294 Bacteria 2976
40 Ga0209025_1029332 3300025294 Bacteria 2665
41 Ga0209025_1157105 3300025294 Bacteria 619
42 Ga0207696_1004634 3300025711 Bacteria 5887
43 Ga0207655_1001484 3300025728 Bacteria 21513
44 Ga0208976_10223 3300027200 Bacteria 612
45 Ga0395900_0882047 3300037418 Bacteria 819
46 Ga0395898_1684126 3300037466 Bacteria 557
47 Ga0395901_1075619 3300038443 Bacteria 776
48 Ga0237819_01244 3300038705 Bacteria 7025
49 Ga0439449_0050726 3300042007 Bacteria 1535
50 Ga0439462_0114106 3300042015 Bacteria 749
51 Ga0495654_0245679 3300046530 Bacteria 747
52 Ga0495626_0268637 3300048091 Bacteria 680
53 Ga0496108_0481794 3300048911 Bacteria 1084
54 Ga0496110_0024219 3300048913 Bacteria 5170
55 Ga0496111_0206337 3300048914 Bacteria 1460
56 Ga0496112_0023127 3300048915 Bacteria 5933

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009092 Ga0105250_10118370 Ga0105250_101183702 130
2 iso_pu_bacteria 8022948649 8022951074 133
3 iso_pu_bacteria 2643221729 2644704463 134
4 iso_pu_bacteria 2643221730 2644709157 134
5 iso_pu_bacteria 2703719227 2705993891 134
6 iso_pu_bacteria 2818991441 2819569110 134
7 iso_pu_bacteria 2818991443 2819578963 134
8 iso_pu_bacteria 2865002811 2865005921 134
9 iso_pu_bacteria 2938917290 2938919347 134
10 iso_pu_bacteria 2979083700 2979085653 134
11 iso_pu_bacteria 3006969106 3006972598 134
12 iso_pu_bacteria 8057632132 8057632692 134
13 iso_pu_bacteria 2540341094 2540606909 135
14 iso_pu_bacteria 2571042143 2571528789 135
15 iso_pu_bacteria 2585428059 2587737631 135
16 iso_pu_bacteria 2593339131 2595090899 135
17 iso_pu_bacteria 2643221676 2644423290 135
18 iso_pu_bacteria 2684623153 2686998902 135
19 iso_pu_bacteria 2738543017 2739271885 135
20 iso_pu_bacteria 2757320391 2757568515 135
21 iso_pu_bacteria 2775507177 2777763531 135
22 iso_pu_bacteria 2775507192 2777835743 135
23 iso_pu_bacteria 2788500588 2791215680 135
24 iso_pu_bacteria 2808606399 2809056945 135
25 iso_pu_bacteria 2811994870 2812314100 135
26 iso_pu_bacteria 2816332186 2816861645 135
27 iso_pu_bacteria 2818991451 2819627125 135
28 iso_pu_bacteria 2842682962 2842688546 135
29 iso_pu_bacteria 2849139964 2849145338 135
30 iso_pu_bacteria 2857453340 2857454260 135
31 iso_pu_bacteria 2857586860 2857589310 135
32 iso_pu_bacteria 2860837431 2860839367 135
33 iso_pu_bacteria 2881644220 2881648870 135
34 iso_pu_bacteria 2888578766 2888579596 135
35 iso_pu_bacteria 2898907183 2898909641 135
36 iso_pu_bacteria 2904606771 2904609360 135
37 iso_pu_bacteria 2904755435 2904757678 135
38 iso_pu_bacteria 2919425241 2919426712 135
39 iso_pu_bacteria 2936340661 2936342028 135
40 iso_pu_bacteria 2936361878 2936366651 135
41 iso_pu_bacteria 2939593269 2939595855 135
42 iso_pu_bacteria 2962290636 2962292813 135
43 iso_pu_bacteria 2964375228 2964380063 135
44 iso_pu_bacteria 2969136845 2969138756 135
45 iso_pu_bacteria 2969765954 2969766804 135
46 iso_pu_bacteria 2969770375 2969772551 135
47 iso_pu_bacteria 2977254563 2977259602 135
48 iso_pu_bacteria 2980125574 2980126305 135
49 iso_pu_bacteria 2980492589 2980494558 135
50 iso_pu_bacteria 2990275345 2990275462 135
51 iso_pu_bacteria 3001267043 3001267198 135
52 iso_pu_bacteria 3001272096 3001272674 135
53 iso_pu_bacteria 3001892409 3001898544 135
54 iso_pu_bacteria 3006826541 3006831420 135
55 iso_pu_bacteria 3006973921 3006975048 135
56 iso_pu_bacteria 3006978542 3006983402 135
57 iso_pu_bacteria 8022653035 8022656517 135
58 iso_pu_bacteria 8054280661 8054283948 135
59 iso_pu_bacteria 8055531788 8055536872 135
60 iso_pu_bacteria 8056533031 8056540726 135
61 3300025294 Ga0209025_1029332 Ga0209025_10293323 136
62 iso_pu_bacteria 2857460504 2857465463 136
63 iso_pu_bacteria 2857465823 2857469404 136
64 iso_pu_bacteria 2857591370 2857595196 136
65 iso_pu_bacteria 2929183550 2929188226 136
66 3300002987 JGI25159J45721_1006855 JGI25159J45721_10068552 138
67 3300003187 JGI25151J46595_10010651 JGI25151J46595_100106515 138
68 3300003187 JGI25151J46595_10010947 JGI25151J46595_100109472 138
69 3300003187 JGI25151J46595_10018672 JGI25151J46595_100186722 138
70 3300003187 JGI25151J46595_10024262 JGI25151J46595_100242623 138
71 3300003187 JGI25151J46595_10028205 JGI25151J46595_100282052 138
72 3300003187 JGI25151J46595_10053313 JGI25151J46595_100533132 138
73 3300003751 Ga0055538_1000142 Ga0055538_100014233 138
74 3300003758 Ga0055532_1000088 Ga0055532_100008850 138
75 3300003761 Ga0055535_1008292 Ga0055535_10082923 138
76 3300003781 Ga0055536_1017828 Ga0055536_10178282 138
77 3300003841 Ga0055541_1001261 Ga0055541_10012612 138
78 3300003841 Ga0055541_1001600 Ga0055541_10016002 138
79 3300009036 Ga0105244_10005927 Ga0105244_100059276 138
80 3300009036 Ga0105244_10118890 Ga0105244_101188902 138
81 3300013102 Ga0157371_10083310 Ga0157371_100833102 138
82 3300025224 Ga0209784_100129 Ga0209784_10012933 138
83 3300025225 Ga0209566_100029 Ga0209566_100029237 138
84 3300025225 Ga0209566_100067 Ga0209566_10006731 138
85 3300025225 Ga0209566_100676 Ga0209566_1006768 138
86 3300025229 Ga0209147_100045 Ga0209147_10004568 138
87 3300025229 Ga0209147_100058 Ga0209147_10005848 138
88 3300025242 Ga0209258_101566 Ga0209258_1015663 138
89 3300025284 Ga0209130_1000713 Ga0209130_10007134 138
90 3300025284 Ga0209130_1014996 Ga0209130_10149962 138
91 3300025291 Ga0209675_1041727 Ga0209675_10417272 138
92 3300025292 Ga0209676_1000530 Ga0209676_100053049 138
93 3300025292 Ga0209676_1000574 Ga0209676_100057434 138
94 3300025292 Ga0209676_1012244 Ga0209676_10122443 138
95 3300025292 Ga0209676_1045089 Ga0209676_10450892 138
96 3300025294 Ga0209025_1000703 Ga0209025_100070352 138
97 3300025294 Ga0209025_1000801 Ga0209025_100080133 138
98 3300025294 Ga0209025_1001603 Ga0209025_100160325 138
99 3300025294 Ga0209025_1003715 Ga0209025_10037152 138
100 3300025294 Ga0209025_1006833 Ga0209025_10068333 138
101 3300025294 Ga0209025_1014523 Ga0209025_10145233 138
102 3300025294 Ga0209025_1014866 Ga0209025_10148663 138
103 3300025294 Ga0209025_1025794 Ga0209025_10257941 138
104 3300025294 Ga0209025_1157105 Ga0209025_11571051 138
105 3300025711 Ga0207696_1004634 Ga0207696_10046343 138
106 3300025728 Ga0207655_1001484 Ga0207655_10014848 138
107 3300027200 Ga0208976_10223 Ga0208976_102231 138
108 3300037418 Ga0395900_0882047 Ga0395900_0882047_270_701 138
109 3300037466 Ga0395898_1684126 Ga0395898_1684126_117_536 138
110 3300038443 Ga0395901_1075619 Ga0395901_1075619_174_596 138
111 3300038705 Ga0237819_01244 Ga0237819_01244_2115_2579 138
112 3300042007 Ga0439449_0050726 Ga0439449_0050726_386_808 138
113 3300042015 Ga0439462_0114106 Ga0439462_0114106_299_721 138
114 3300046530 Ga0495654_0245679 Ga0495654_0245679_73_495 138
115 3300048091 Ga0495626_0268637 Ga0495626_0268637_179_601 138
116 3300048911 Ga0496108_0481794 Ga0496108_0481794_434_856 138
117 3300048913 Ga0496110_0024219 Ga0496110_0024219_2193_2615 138
118 3300048914 Ga0496111_0206337 Ga0496111_0206337_341_763 138
119 3300048915 Ga0496112_0023127 Ga0496112_0023127_4751_5173 138
120 iso_pu_bacteria 2996706504 2996711708 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

32

144

0.98

PF12681

Glyoxalase_2

Glyoxalase-like domain

33

147

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f6q-assembly1.cif.gz_A crystal structure of metallothiol transferase from bacillus anthracis str. ames 0.973 1 138
7n7g-assembly1.cif.gz_B crystal structure of fosb from enterococcus faecium with fosfomycin 0.9701 1 138
7n7g-assembly1.cif.gz_A crystal structure of fosb from enterococcus faecium with fosfomycin 0.9697 1 138
8dtd-assembly1.cif.gz_A crystal structure of fosb from bacillus cereus with zinc and phosphonoformate 0.9693 1 138
5f6q-assembly1.cif.gz_A crystal structure of metallothiol transferase from bacillus anthracis str. ames 0.9662 1 138
ID Description Score Start End Superfamily
4nazA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9286 1 135 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9216 1 125 3.10.180.10
4nazA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9145 1 135 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9144 1 125 3.10.180.10
5wewB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8902 1 138 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A6N3WIW1-F1-model_v4 deleted 0.981 3 138
AF-A0A417Z0G9-F1-model_v4 Metallothiol transferase FosB (EC 2.5.1.-) (Fosfomycin resistance protein) 0.9807 2 138 GO:0000287
GO:0005737
GO:0016765
GO:0046677
AF-A0A3G8R461-F1-model_v4 Metallothiol transferase FosB (EC 2.5.1.-) (Fosfomycin resistance protein) 0.9806 1 138 GO:0000287
GO:0005737
GO:0016765
GO:0046677
AF-A0A7X9MVQ3-F1-model_v4 Metallothiol transferase FosB (EC 2.5.1.-) (Fosfomycin resistance protein) 0.9804 2 138 GO:0000287
GO:0005737
GO:0016765
GO:0046677
AF-A0A4R1B1M7-F1-model_v4 Metallothiol transferase FosB (EC 2.5.1.-) (Fosfomycin resistance protein) 0.9799 1 138 GO:0000287
GO:0005737
GO:0016747
GO:0016765
GO:0046677

Feature Viewer

pLDDT pTM Quality
91.83 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map