F104823

General Info

Members Datasets Scaffolds Average Seq Length
120 93 120 164

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10036768|Ga0070709_100367683
Length 167
Sequence MSKYWLAQVNFGRIRAPLDSEVMRGFMSRLEEINALADSSPGFVWRLQTPEGDATYLRPYPEDDRILLNMSVWESVEALRHYVYRTGHAELLRHRHEWFEKFSGSYLALWWVPAGHIPSIDEAKKRVAHLDANGPTQFAFTFKTIFPADDAFQQSIDWSSFQPCPAM

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
66 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
67 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
68 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
69 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
79 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
80 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
81 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
84 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
85 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
86 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
87 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
88 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
89 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
90 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
91 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
92 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
93 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 1.67
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007993 3300003203 Bacteria 4807
2 Ga0070683_100490652 3300005329 Bacteria 1173
3 Ga0070689_100672552 3300005340 Bacteria 902
4 Ga0070687_100210393 3300005343 Bacteria 1184
5 Ga0070675_100000018 3300005354 Bacteria 178025
6 Ga0070673_100868594 3300005364 Bacteria 835
7 Ga0070709_10036768 3300005434 Bacteria 2986
8 Ga0070713_100091339 3300005436 Bacteria 2619
9 Ga0070700_100000074 3300005441 Bacteria 69625
10 Ga0070700_100349294 3300005441 Bacteria 1096
11 Ga0070708_100855893 3300005445 Bacteria 854
12 Ga0070707_101045416 3300005468 Unclassified 782
13 Ga0070698_100117821 3300005471 Bacteria 2618
14 Ga0070698_100937242 3300005471 Unclassified 812
15 Ga0070699_100400827 3300005518 Bacteria 1240
16 Ga0070699_100531905 3300005518 Unclassified 1069
17 Ga0070697_100108487 3300005536 Bacteria 2311
18 Ga0070693_100027348 3300005547 Bacteria 3090
19 Ga0070693_100208908 3300005547 Bacteria 1273
20 Ga0068861_100632646 3300005719 Bacteria 986
21 Ga0081539_10005033 3300005985 Bacteria 13908
22 Ga0070717_10294583 3300006028 Unclassified 1441
23 Ga0070716_100043911 3300006173 Bacteria 2502
24 Ga0070716_100346223 3300006173 Bacteria 1050
25 Ga0075428_100850472 3300006844 Bacteria 969
26 Ga0075431_100001672 3300006847 Bacteria 20809
27 Ga0075433_10314421 3300006852 Bacteria 1386
28 Ga0075434_100072233 3300006871 Unclassified 3443
29 Ga0075434_100321890 3300006871 Unclassified 1567
30 Ga0075434_101246006 3300006871 Bacteria 755
31 Ga0075429_100201854 3300006880 Bacteria 1742
32 Ga0075429_100416404 3300006880 Bacteria 1177
33 Ga0068865_100086265 3300006881 Bacteria 2266
34 Ga0075436_100454459 3300006914 Unclassified 933
35 Ga0075435_100024344 3300007076 Bacteria 4697
36 Ga0105244_10021706 3300009036 Bacteria 3546
37 Ga0105240_10067403 3300009093 Bacteria 4436
38 Ga0111539_10000004 3300009094 Bacteria 751278
39 Ga0105245_10004168 3300009098 Bacteria 12841
40 Ga0114129_10002571 3300009147 Bacteria 25219
41 Ga0114129_10168039 3300009147 Bacteria 2992
42 Ga0114129_10186252 3300009147 Bacteria 2821
43 Ga0105241_11213882 3300009174 Unclassified 715
44 Ga0105242_10001055 3300009176 Bacteria 21670
45 Ga0105238_10323243 3300009551 Unclassified 1529
46 Ga0163162_10011756 3300013306 Bacteria 8538
47 Ga0157375_10000002 3300013308 Bacteria 495826
48 Ga0157380_10865846 3300014326 Bacteria 927
49 Ga0213873_10000001 3300021358 Bacteria 1657979
50 Ga0213876_10000002 3300021384 Bacteria 1168769
51 Ga0207699_10014892 3300025906 Bacteria 4026
52 Ga0207695_10071722 3300025913 Bacteria 3537
53 Ga0207662_10354930 3300025918 Bacteria 986
54 Ga0207646_10648842 3300025922 Unclassified 946
55 Ga0207659_10000025 3300025926 Bacteria 139965
56 Ga0207687_10002337 3300025927 Bacteria 12915
57 Ga0207700_10241670 3300025928 Bacteria 1539
58 Ga0207686_10001580 3300025934 Bacteria 12813
59 Ga0207670_10627260 3300025936 Bacteria 884
60 Ga0207665_10109656 3300025939 Bacteria 1938
61 Ga0207665_10166247 3300025939 Bacteria 1590
62 Ga0207691_10000783 3300025940 Bacteria 31540
63 Ga0207661_11213300 3300025944 Unclassified 694
64 Ga0207651_10864960 3300025960 Bacteria 804
65 Ga0207708_10000007 3300026075 Bacteria 264612
66 Ga0207708_10306871 3300026075 Bacteria 1292
67 Ga0207675_101570013 3300026118 Unclassified 679
68 Ga0207428_10000006 3300027907 Bacteria 491716
69 Ga0265319_1007565 3300028563 Bacteria 4865
70 Ga0265338_10165582 3300028800 Bacteria 1702
71 Ga0265332_10301482 3300031238 Bacteria 662
72 Ga0265320_10109425 3300031240 Bacteria 1267
73 Ga0265331_10007072 3300031250 Bacteria 6544
74 Ga0265331_10020466 3300031250 Bacteria 3395
75 Ga0265331_10127149 3300031250 Bacteria 1164
76 Ga0265331_10159667 3300031250 Bacteria 1022
77 Ga0265316_10006304 3300031344 Bacteria 11357
78 Ga0265316_10010279 3300031344 Bacteria 8537
79 Ga0265316_10599983 3300031344 Bacteria 781
80 Ga0265314_10088453 3300031711 Bacteria 2023
81 Ga0265342_10151520 3300031712 Bacteria 1287
82 Ga0265342_10166717 3300031712 Bacteria 1214
83 Ga0265342_10209710 3300031712 Bacteria 1054
84 Ga0373951_0040107 3300035091 Unclassified 1127
85 Ga0373932_0000730 3300035112 Bacteria 9888
86 Ga0373941_0173935 3300035115 Bacteria 804
87 Ga0373960_0010726 3300035121 Bacteria 2245
88 Ga0373943_0850045 3300035170 Unclassified 544
89 Ga0436364_0742301 3300037853 Bacteria 913
90 Ga0436364_0795476 3300037853 Bacteria 817
91 Ga0400485_12490 3300038735 Bacteria 1576
92 Ga0436365_0862132 3300039437 Bacteria 257735
93 Ga0436362_0842419 3300039453 Bacteria 317447
94 Ga0451839_0456513 3300041496 Bacteria 569
95 Ga0451577_0094507 3300042876 Unclassified 2670
96 Ga0466963_0325431 3300044694 Unclassified 1082
97 Ga0466959_0198007 3300045049 Unclassified 1400
98 Ga0496101_0766720 3300048904 Unclassified 761
99 Ga0496104_0160897 3300048907 Bacteria 2154
100 Ga0501073_0021819 3300049589 Bacteria 4613
101 Ga0501074_0351953 3300049590 Bacteria 1045
102 Ga0501080_0125229 3300049742 Bacteria 2380
103 nmdc:mga05p37_184472_c1 3300050507 Bacteria 2537
104 nmdc:mga05p37_26213_c1 3300050507 Bacteria 7088
105 nmdc:mga09592_264416_c1 3300050508 Bacteria 1492
106 nmdc:mga09592_277637_c1 3300050508 Bacteria 1453
107 nmdc:mga06r32_4489_c1 3300050510 Bacteria 12493
108 nmdc:mga08y16_5_c1 3300050511 Bacteria 751284
109 nmdc:mga0n895_1238586_c1 3300050512 Bacteria 719
110 nmdc:mga0n895_1401255_c1 3300050512 Unclassified 667
111 nmdc:mga0n895_321832_c1 3300050512 Unclassified 1567
112 nmdc:mga0n895_639030_c1 3300050512 Bacteria 1064
113 nmdc:mga0n895_64120_c1 3300050512 Unclassified 3634
114 nmdc:mga0rr50_18165_c1 3300050513 Bacteria 4717
115 nmdc:mga08x19_1301648_c1 3300050514 Bacteria 515
116 nmdc:mga08x19_794997_c1 3300050514 Bacteria 672
117 Ga0500622_0006084 3300053156 Bacteria 7088
118 Ga0501084_0882939 3300054114 Unclassified 752
119 Ga0466962_0238232 3300061719 Unclassified 893
120 Ga0530510_0351355 3300061734 Bacteria 1107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0850045 Ga0373943_0850045_18_452 144
2 3300050514 nmdc:mga08x19_1301648_c1 nmdc:mga08x19_1301648_c1_27_461 144
3 3300009174 Ga0105241_11213882 Ga0105241_112138822 145
4 3300028563 Ga0265319_1007565 Ga0265319_10075652 145
5 3300031240 Ga0265320_10109425 Ga0265320_101094251 145
6 3300031250 Ga0265331_10007072 Ga0265331_100070723 145
7 3300031344 Ga0265316_10006304 Ga0265316_1000630410 145
8 3300031711 Ga0265314_10088453 Ga0265314_100884533 145
9 3300031712 Ga0265342_10166717 Ga0265342_101667172 145
10 3300041496 Ga0451839_0456513 Ga0451839_0456513_13_450 145
11 3300038735 Ga0400485_12490 Ga0400485_12490_700_1155 146
12 3300049590 Ga0501074_0351953 Ga0501074_0351953_319_765 147
13 3300053156 Ga0500622_0006084 Ga0500622_0006084_2486_2962 149
14 3300005518 Ga0070699_100400827 Ga0070699_1004008272 150
15 3300009176 Ga0105242_10001055 Ga0105242_100010555 151
16 3300025934 Ga0207686_10001580 Ga0207686_100015804 151
17 3300049589 Ga0501073_0021819 Ga0501073_0021819_3292_3753 153
18 3300049742 Ga0501080_0125229 Ga0501080_0125229_1331_1792 153
19 3300009147 Ga0114129_10186252 Ga0114129_101862522 154
20 3300050507 nmdc:mga05p37_184472_c1 nmdc:mga05p37_184472_c1_202_666 154
21 3300021358 Ga0213873_10000001 Ga0213873_100000011404 158
22 3300021384 Ga0213876_10000002 Ga0213876_10000002135 158
23 3300037853 Ga0436364_0795476 Ga0436364_0795476_179_655 158
24 3300039437 Ga0436365_0862132 Ga0436365_0862132_221193_221675 158
25 3300039453 Ga0436362_0842419 Ga0436362_0842419_288119_288601 158
26 3300007076 Ga0075435_100024344 Ga0075435_1000243445 159
27 3300050513 nmdc:mga0rr50_18165_c1 nmdc:mga0rr50_18165_c1_2606_3085 159
28 3300044694 Ga0466963_0325431 Ga0466963_0325431_552_1040 161
29 3300045049 Ga0466959_0198007 Ga0466959_0198007_526_1014 161
30 3300054114 Ga0501084_0882939 Ga0501084_0882939_213_707 161
31 3300061719 Ga0466962_0238232 Ga0466962_0238232_173_661 161
32 3300006173 Ga0070716_100346223 Ga0070716_1003462232 162
33 3300025939 Ga0207665_10166247 Ga0207665_101662473 162
34 3300005340 Ga0070689_100672552 Ga0070689_1006725522 163
35 3300005518 Ga0070699_100531905 Ga0070699_1005319052 163
36 3300005719 Ga0068861_100632646 Ga0068861_1006326462 163
37 3300006844 Ga0075428_100850472 Ga0075428_1008504722 163
38 3300006871 Ga0075434_100072233 Ga0075434_1000722332 163
39 3300006880 Ga0075429_100416404 Ga0075429_1004164043 163
40 3300009147 Ga0114129_10002571 Ga0114129_100025717 163
41 3300025936 Ga0207670_10627260 Ga0207670_106272602 163
42 3300035112 Ga0373932_0000730 Ga0373932_0000730_8985_9482 163
43 3300050507 nmdc:mga05p37_26213_c1 nmdc:mga05p37_26213_c1_3011_3511 163
44 3300050508 nmdc:mga09592_264416_c1 nmdc:mga09592_264416_c1_897_1397 163
45 3300050512 nmdc:mga0n895_64120_c1 nmdc:mga0n895_64120_c1_2570_3067 163
46 3300005329 Ga0070683_100490652 Ga0070683_1004906522 164
47 3300005343 Ga0070687_100210393 Ga0070687_1002103931 164
48 3300005434 Ga0070709_10036768 Ga0070709_100367683 164
49 3300005436 Ga0070713_100091339 Ga0070713_1000913393 164
50 3300005441 Ga0070700_100349294 Ga0070700_1003492942 164
51 3300005468 Ga0070707_101045416 Ga0070707_1010454162 164
52 3300005547 Ga0070693_100027348 Ga0070693_1000273483 164
53 3300005547 Ga0070693_100208908 Ga0070693_1002089082 164
54 3300006173 Ga0070716_100043911 Ga0070716_1000439113 164
55 3300006852 Ga0075433_10314421 Ga0075433_103144212 164
56 3300006871 Ga0075434_101246006 Ga0075434_1012460062 164
57 3300006880 Ga0075429_100201854 Ga0075429_1002018542 164
58 3300009093 Ga0105240_10067403 Ga0105240_100674033 164
59 3300009551 Ga0105238_10323243 Ga0105238_103232431 164
60 3300025906 Ga0207699_10014892 Ga0207699_100148925 164
61 3300025913 Ga0207695_10071722 Ga0207695_100717223 164
62 3300025918 Ga0207662_10354930 Ga0207662_103549302 164
63 3300025922 Ga0207646_10648842 Ga0207646_106488422 164
64 3300025928 Ga0207700_10241670 Ga0207700_102416702 164
65 3300025939 Ga0207665_10109656 Ga0207665_101096562 164
66 3300025944 Ga0207661_11213300 Ga0207661_112133001 164
67 3300026075 Ga0207708_10306871 Ga0207708_103068712 164
68 3300028800 Ga0265338_10165582 Ga0265338_101655822 164
69 3300031238 Ga0265332_10301482 Ga0265332_103014821 164
70 3300031250 Ga0265331_10020466 Ga0265331_100204662 164
71 3300031250 Ga0265331_10127149 Ga0265331_101271492 164
72 3300031250 Ga0265331_10159667 Ga0265331_101596672 164
73 3300031344 Ga0265316_10599983 Ga0265316_105999832 164
74 3300031712 Ga0265342_10151520 Ga0265342_101515202 164
75 3300035091 Ga0373951_0040107 Ga0373951_0040107_48_548 164
76 3300035115 Ga0373941_0173935 Ga0373941_0173935_71_571 164
77 3300035121 Ga0373960_0010726 Ga0373960_0010726_1281_1781 164
78 3300037853 Ga0436364_0742301 Ga0436364_0742301_147_647 164
79 3300042876 Ga0451577_0094507 Ga0451577_0094507_264_764 164
80 3300048904 Ga0496101_0766720 Ga0496101_0766720_236_736 164
81 3300050508 nmdc:mga09592_277637_c1 nmdc:mga09592_277637_c1_120_629 164
82 3300050512 nmdc:mga0n895_1238586_c1 nmdc:mga0n895_1238586_c1_124_621 164
83 3300050512 nmdc:mga0n895_1401255_c1 nmdc:mga0n895_1401255_c1_34_534 164
84 3300050512 nmdc:mga0n895_639030_c1 nmdc:mga0n895_639030_c1_401_901 164
85 3300061734 Ga0530510_0351355 Ga0530510_0351355_240_743 164
86 3300005354 Ga0070675_100000018 Ga0070675_10000001866 165
87 3300005364 Ga0070673_100868594 Ga0070673_1008685942 165
88 3300005441 Ga0070700_100000074 Ga0070700_10000007430 165
89 3300006028 Ga0070717_10294583 Ga0070717_102945832 165
90 3300006847 Ga0075431_100001672 Ga0075431_1000016724 165
91 3300006871 Ga0075434_100321890 Ga0075434_1003218902 165
92 3300006914 Ga0075436_100454459 Ga0075436_1004544591 165
93 3300009036 Ga0105244_10021706 Ga0105244_100217064 165
94 3300009094 Ga0111539_10000004 Ga0111539_10000004177 165
95 3300014326 Ga0157380_10865846 Ga0157380_108658461 165
96 3300025926 Ga0207659_10000025 Ga0207659_1000002564 165
97 3300025960 Ga0207651_10864960 Ga0207651_108649602 165
98 3300026075 Ga0207708_10000007 Ga0207708_10000007116 165
99 3300026118 Ga0207675_101570013 Ga0207675_1015700131 165
100 3300027907 Ga0207428_10000006 Ga0207428_10000006177 165
101 3300048907 Ga0496104_0160897 Ga0496104_0160897_879_1457 165
102 3300050510 nmdc:mga06r32_4489_c1 nmdc:mga06r32_4489_c1_8615_9118 165
103 3300050511 nmdc:mga08y16_5_c1 nmdc:mga08y16_5_c1_574957_575460 165
104 3300050512 nmdc:mga0n895_321832_c1 nmdc:mga0n895_321832_c1_524_1030 165
105 3300050514 nmdc:mga08x19_794997_c1 nmdc:mga08x19_794997_c1_103_609 165
106 3300003203 JGI25406J46586_10007993 JGI25406J46586_100079933 166
107 3300005445 Ga0070708_100855893 Ga0070708_1008558931 166
108 3300005471 Ga0070698_100117821 Ga0070698_1001178212 166
109 3300005471 Ga0070698_100937242 Ga0070698_1009372422 166
110 3300005536 Ga0070697_100108487 Ga0070697_1001084874 166
111 3300005985 Ga0081539_10005033 Ga0081539_100050333 166
112 3300006881 Ga0068865_100086265 Ga0068865_1000862652 166
113 3300009098 Ga0105245_10004168 Ga0105245_1000416816 166
114 3300009147 Ga0114129_10168039 Ga0114129_101680393 166
115 3300013306 Ga0163162_10011756 Ga0163162_1001175610 166
116 3300013308 Ga0157375_10000002 Ga0157375_10000002287 166
117 3300025927 Ga0207687_10002337 Ga0207687_1000233716 166
118 3300025940 Ga0207691_10000783 Ga0207691_1000078320 166
119 3300031344 Ga0265316_10010279 Ga0265316_100102798 166
120 3300031712 Ga0265342_10209710 Ga0265342_102097101 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11695

DUF3291

Domain of unknown function (DUF3291)

6

145

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kg1-assembly3.cif.gz_A-2 crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a 0.7208 3 114
2bbe-assembly1.cif.gz_A crystal structure of protein so0527 from shewanella oneidensis 0.7206 3 109
3kng-assembly1.cif.gz_B crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, determined to 1.9 resolution 0.7158 1 114
2qyc-assembly1.cif.gz_A crystal structure of a dimeric ferredoxin-like protein (bb1511) from bordetella bronchiseptica rb50 at 1.90 a resolution 0.7125 1 111
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.7072 1 116
ID Description Score Start End Superfamily
af_Q8BG18_205_343_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8096 2 110 3.30.70.100
af_Q54CJ9_3_103_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7909 1 110 3.30.70.100
af_Q54CJ9_3_103_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7711 1 110 3.30.70.100
3mcsA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7689 3 106 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7582 3 109 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7Y3GR80-F1-model_v4 DUF3291 domain-containing protein 0.985 68 146
AF-A0A3B0WG05-F1-model_v4 DUF3291 domain-containing protein 0.9803 67 146
AF-A0A1H8TEL6-F1-model_v4 DUF3291 domain-containing protein 0.9773 2 145
AF-A0A3D1SPE4-F1-model_v4 DUF3291 domain-containing protein 0.9764 1 148
AF-A0A1K2H4V4-F1-model_v4 DUF3291 domain-containing protein 0.9763 2 147

Feature Viewer

pLDDT pTM Quality
85.4 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map