F101657

General Info

Members Datasets Scaffolds Average Seq Length
119 76 101 232

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10003516|Ga0157370_100035168
Length 262
Sequence MRSLSKGIRPGTVTIRNSLANGCRKAALLITKIKNVMKSYMVILPVSAMTICVSLPKGANAQIAVLEVIKAGVKKVIRAVDLKVQRLQNETIWLQNAQKVLENQLSKLKLTEIADWTERQKELYAEYYTSLWKVKSAITYYKRIKELTVKQIAIVDEYKWTYGLFQKDKHFSASELDEMQKVYLGILEESVKNLDQVLLVVNSFKTQMSDGKRLEIINAAAQKMEENYTDLKQFNAGNISLSIERAASVDEVAKLKELYDVR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2739367663 Pedobacter sp. YR510 Isolate Unclassified
7 2818991437 Pedobacter terrae 518 Isolate Unclassified
8 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
9 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
10 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
11 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
12 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
13 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
14 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
15 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
16 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
17 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
18 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
19 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
42 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
43 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
60 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
64 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
65 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
66 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
67 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
68 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
69 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
70 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
71 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
72 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
74 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
75 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
76 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.03
Metatranscriptomes 0
Isolates 15.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.04
Nodule 0
Rhizoplane 0.84
Rhizosphere 78.15
Stem 0
Stem Tuber 0
Unclassified 15.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1596339 2162886007 Bacteria 98699
2 SwRhRL2b_contig_2418591 2162886007 Bacteria 39679
3 SwRhRL2b_contig_844519 2162886007 Bacteria 7391
4 JGI25157J39369_1004236 3300002741 Bacteria 2663
5 rootH1_10100755 3300003316 Bacteria 4422
6 rootH2_10001891 3300003320 Bacteria 464318
7 rootH1_10000566 3300003316 Bacteria 33162
8 rootH1_10000566 3300003323 Bacteria 205679
9 rootH1_10047463 3300003323 Bacteria 6459
10 rootH1_10145518 3300003323 Bacteria 5372
11 Ga0055536_1000008 3300003781 Bacteria 335729
12 Ga0055530_10011274 3300003791 Bacteria 3223
13 Ga0065714_10002368 3300005288 Bacteria 21371
14 Ga0065714_10064434 3300005288 Bacteria 130989
15 Ga0065714_10064472 3300005288 Bacteria 60575
16 Ga0065714_10075151 3300005288 Bacteria 2940
17 Ga0065714_10210194 3300005288 Bacteria 869
18 Ga0065704_10000199 3300005289 Bacteria 297176
19 Ga0065704_10000221 3300005289 Bacteria 134976
20 Ga0065704_10070168 3300005289 Bacteria 171820
21 Ga0065704_10079590 3300005289 Bacteria 4122
22 Ga0068853_100011837 3300005539 Bacteria 7092
23 Ga0068855_100002488 3300005563 Bacteria 22689
24 Ga0105240_10104831 3300009093 Bacteria 3433
25 Ga0105237_10000533 3300009545 Bacteria 53639
26 Ga0105249_10280431 3300009553 Unclassified 1664
27 Ga0105239_10000006 3300010375 Bacteria 442319
28 Ga0157373_10000048 3300013100 Bacteria 110104
29 Ga0157371_10010792 3300013102 Bacteria 7091
30 Ga0157371_10083222 3300013102 Bacteria 2266
31 Ga0157371_10109866 3300013102 Bacteria 1957
32 Ga0157370_10000072 3300013104 Bacteria 110176
33 Ga0157370_10000205 3300013104 Bacteria 74877
34 Ga0157370_10000418 3300013104 Bacteria 53630
35 Ga0157370_10000492 3300013104 Bacteria 49180
36 Ga0157370_10002245 3300013104 Bacteria 23478
37 Ga0157370_10003516 3300013104 Bacteria 18363
38 Ga0157370_10010782 3300013104 Bacteria 9610
39 Ga0157370_10054385 3300013104 Bacteria 3816
40 Ga0157370_10109487 3300013104 Bacteria 2582
41 Ga0157369_10000419 3300013105 Bacteria 56158
42 Ga0157372_10014772 3300013307 Bacteria 8358
43 Ga0157372_10119232 3300013307 Bacteria 3029
44 Ga0157372_10365250 3300013307 Bacteria 1682
45 Ga0157375_10083030 3300013308 Bacteria 3248
46 Ga0157375_10337232 3300013308 Bacteria 1673
47 Ga0182008_10010175 3300014497 Bacteria 5041
48 Ga0182006_1033769 3300015261 Unclassified 2049
49 Ga0183373_1010 3300015682 Bacteria 196982
50 Ga0209026_1000254 3300025250 Bacteria 66928
51 Ga0209233_1000604 3300025261 Bacteria 18532
52 Ga0209676_1000042 3300025292 Bacteria 424130
53 Ga0209050_1000035 3300025298 Bacteria 424005
54 Ga0207647_10000140 3300025904 Bacteria 57457
55 Ga0207671_10000850 3300025914 Bacteria 38725
56 Ga0207671_10004430 3300025914 Bacteria 13448
57 Ga0207639_10008112 3300026041 Bacteria 7179
58 Ga0207641_10102478 3300026088 Bacteria 2524
59 Ga0207674_10012462 3300026116 Bacteria 9501
60 Ga0307515_10067608 3300028794 Bacteria 4925
61 Ga0307515_10068404 3300028794 Bacteria 4879
62 Ga0307408_100000225 3300031548 Bacteria 60134
63 Ga0307408_100000573 3300031548 Bacteria 31741
64 Ga0307408_100001340 3300031548 Bacteria 18454
65 Ga0307508_10352987 3300031616 Bacteria 1062
66 Ga0307407_10000040 3300031903 Bacteria 66966
67 Ga0307412_10000063 3300031911 Bacteria 125959
68 Ga0307412_10006627 3300031911 Bacteria 6562
69 Ga0307412_10048105 3300031911 Bacteria 2803
70 Ga0307412_10188890 3300031911 Unclassified 1556
71 Ga0307409_100061809 3300031995 Bacteria 2929
72 Ga0307416_100000009 3300032002 Bacteria 374271
73 Ga0307416_100138960 3300032002 Bacteria 2204
74 Ga0307414_10000862 3300032004 Bacteria 15483
75 Ga0307414_10000923 3300032004 Bacteria 15036
76 Ga0307414_10031576 3300032004 Bacteria 3477
77 Ga0307414_10033442 3300032004 Bacteria 3399
78 Ga0307414_10132432 3300032004 Bacteria 1938
79 Ga0307414_10297557 3300032004 Bacteria 1363
80 Ga0307414_10386548 3300032004 Bacteria 1211
81 Ga0307507_10000141 3300033179 Bacteria 125001
82 Ga0395899_0000001 3300037312 Bacteria 1750322
83 Ga0466966_0000657 3300044684 Bacteria 22017
84 Ga0466961_0011210 3300044693 Bacteria 5732
85 Ga0495585_0039163 3300046492 Unclassified 2665
86 Ga0495606_0020369 3300046507 Bacteria 4893
87 Ga0495610_0000149 3300046512 Bacteria 77136
88 Ga0495648_0000542 3300046524 Bacteria 40768
89 Ga0495609_0019478 3300046538 Bacteria 3140
90 Ga0495633_0000167 3300046558 Bacteria 86373
91 Ga0495633_0006046 3300046558 Bacteria 7260
92 Ga0495660_0040780 3300046810 Bacteria 2572
93 Ga0495660_0164856 3300046810 Bacteria 1084
94 Ga0496122_0001002 3300048925 Bacteria 50067
95 Ga0496123_0003369 3300048926 Bacteria 18069
96 Ga0501047_0495752 3300049581 Bacteria 1048
97 Ga0501223_000799 3300049663 Bacteria 7466
98 Ga0501241_004030 3300049758 Bacteria 2764
99 Ga0501241_017863 3300049758 Bacteria 1298
100 Ga0501280_004898 3300049776 Bacteria 1939
101 nmdc:mga0k408_7700_c1 3300050493 Bacteria 5757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10001891 rootH2_10001891304 210
2 3300009553 Ga0105249_10280431 Ga0105249_102804313 210
3 3300046524 Ga0495648_0000542 Ga0495648_0000542_6729_7379 211
4 3300003323 rootH1_10000566 rootH1_10000566106 212
5 3300046538 Ga0495609_0019478 Ga0495609_0019478_2076_2714 212
6 3300046558 Ga0495633_0000167 Ga0495633_0000167_24500_25138 212
7 3300046810 Ga0495660_0164856 Ga0495660_0164856_415_1053 212
8 3300005539 Ga0068853_100011837 Ga0068853_1000118374 215
9 3300026041 Ga0207639_10008112 Ga0207639_100081124 215
10 3300044693 Ga0466961_0011210 Ga0466961_0011210_548_1195 215
11 3300049776 Ga0501280_004898 Ga0501280_004898_1001_1648 215
12 2162886007 SwRhRL2b_contig_2418591 SwRhRL2b_0841.00006380 216
13 3300005289 Ga0065704_10000199 Ga0065704_10000199188 216
14 3300013307 Ga0157372_10365250 Ga0157372_103652503 216
15 3300025914 Ga0207671_10004430 Ga0207671_100044303 216
16 3300049581 Ga0501047_0495752 Ga0501047_0495752_214_873 219
17 3300013104 Ga0157370_10054385 Ga0157370_100543854 220
18 3300049663 Ga0501223_000799 Ga0501223_000799_2688_3359 220
19 iso_pu_bacteria 2884933994 2884935326 221
20 3300005288 Ga0065714_10064472 Ga0065714_1006447226 222
21 3300009093 Ga0105240_10104831 Ga0105240_101048313 222
22 3300010375 Ga0105239_10000006 Ga0105239_10000006308 222
23 3300013102 Ga0157371_10083222 Ga0157371_100832223 222
24 3300014497 Ga0182008_10010175 Ga0182008_100101754 222
25 3300046492 Ga0495585_0039163 Ga0495585_0039163_71_739 222
26 3300046810 Ga0495660_0040780 Ga0495660_0040780_1330_1998 222
27 3300050493 nmdc:mga0k408_7700_c1 nmdc:mga0k408_7700_c1_5027_5695 222
28 iso_pu_bacteria 2599185184 2599476698 222
29 iso_pu_bacteria 2902048731 2902052665 222
30 iso_pu_bacteria 2904780799 2904785301 222
31 iso_pu_bacteria 2928078545 2928081493 222
32 iso_pu_bacteria 2977232053 2977232222 222
33 3300005288 Ga0065714_10075151 Ga0065714_100751512 223
34 3300013102 Ga0157371_10109866 Ga0157371_101098662 223
35 3300013104 Ga0157370_10000418 Ga0157370_1000041845 223
36 3300013308 Ga0157375_10337232 Ga0157375_103372323 223
37 3300031911 Ga0307412_10048105 Ga0307412_100481052 223
38 iso_pu_bacteria 2738541283 2738757330 223
39 iso_pu_bacteria 2738543023 2739304758 223
40 iso_pu_bacteria 2895498888 2895501533 223
41 3300003316 rootH1_10100755 rootH1_101007553 224
42 3300003323 rootH1_10145518 rootH1_101455183 224
43 3300005563 Ga0068855_100002488 Ga0068855_10000248818 224
44 3300026088 Ga0207641_10102478 Ga0207641_101024782 225
45 3300031911 Ga0307412_10006627 Ga0307412_100066276 225
46 3300032002 Ga0307416_100138960 Ga0307416_1001389602 225
47 2162886007 SwRhRL2b_contig_844519 SwRhRL2b_0837.00007250 226
48 3300002741 JGI25157J39369_1004236 JGI25157J39369_10042363 226
49 3300003323 rootH1_10047463 rootH1_100474633 226
50 3300005289 Ga0065704_10000221 Ga0065704_1000022163 226
51 3300013105 Ga0157369_10000419 Ga0157369_1000041937 226
52 3300013307 Ga0157372_10014772 Ga0157372_100147727 226
53 3300025250 Ga0209026_1000254 Ga0209026_10002544 226
54 3300025261 Ga0209233_1000604 Ga0209233_100060413 226
55 3300025904 Ga0207647_10000140 Ga0207647_1000014010 226
56 3300026116 Ga0207674_10012462 Ga0207674_100124629 226
57 3300028794 Ga0307515_10067608 Ga0307515_100676083 226
58 3300031548 Ga0307408_100000573 Ga0307408_10000057323 226
59 3300031616 Ga0307508_10352987 Ga0307508_103529871 226
60 3300032004 Ga0307414_10031576 Ga0307414_100315764 226
61 3300033179 Ga0307507_10000141 Ga0307507_1000014117 226
62 3300037312 Ga0395899_0000001 Ga0395899_0000001_268570_269253 226
63 3300044684 Ga0466966_0000657 Ga0466966_0000657_18552_19235 226
64 3300046507 Ga0495606_0020369 Ga0495606_0020369_888_1571 226
65 3300031548 Ga0307408_100001340 Ga0307408_10000134011 227
66 3300048925 Ga0496122_0001002 Ga0496122_0001002_17155_17838 227
67 3300048926 Ga0496123_0003369 Ga0496123_0003369_7148_7831 227
68 iso_pu_bacteria 2818991437 2819549230 228
69 iso_pu_bacteria 2585427687 2586207984 229
70 iso_pu_bacteria 2902048731 2902049140 229
71 3300049758 Ga0501241_004030 Ga0501241_004030_277_969 230
72 3300031903 Ga0307407_10000040 Ga0307407_1000004036 232
73 iso_pu_bacteria 2939664404 2939668023 232
74 3300005289 Ga0065704_10079590 Ga0065704_100795903 233
75 3300013102 Ga0157371_10010792 Ga0157371_100107927 233
76 3300013104 Ga0157370_10000205 Ga0157370_1000020546 233
77 3300013104 Ga0157370_10109487 Ga0157370_101094872 233
78 3300031911 Ga0307412_10000063 Ga0307412_1000006380 233
79 3300032004 Ga0307414_10033442 Ga0307414_100334424 233
80 3300032004 Ga0307414_10297557 Ga0307414_102975572 233
81 3300032004 Ga0307414_10386548 Ga0307414_103865482 233
82 iso_pu_bacteria 2852627209 2852630054 233
83 3300005288 Ga0065714_10002368 Ga0065714_1000236814 236
84 3300013104 Ga0157370_10000072 Ga0157370_1000007241 236
85 3300013308 Ga0157375_10083030 Ga0157375_100830301 236
86 3300032004 Ga0307414_10132432 Ga0307414_101324321 237
87 3300049758 Ga0501241_017863 Ga0501241_017863_135_848 237
88 3300005288 Ga0065714_10210194 Ga0065714_102101941 240
89 3300013100 Ga0157373_10000048 Ga0157373_1000004825 240
90 3300015261 Ga0182006_1033769 Ga0182006_10337693 240
91 3300032004 Ga0307414_10000923 Ga0307414_1000092311 240
92 iso_pu_bacteria 2902048731 2902051851 241
93 3300009545 Ga0105237_10000533 Ga0105237_1000053327 242
94 3300025914 Ga0207671_10000850 Ga0207671_100008503 242
95 3300046558 Ga0495633_0006046 Ga0495633_0006046_252_986 244
96 3300013104 Ga0157370_10002245 Ga0157370_1000224511 245
97 3300028794 Ga0307515_10068404 Ga0307515_100684043 245
98 3300005288 Ga0065714_10064434 Ga0065714_1006443476 246
99 3300013104 Ga0157370_10000492 Ga0157370_1000049227 246
100 3300013307 Ga0157372_10119232 Ga0157372_101192323 246
101 3300015682 Ga0183373_1010 Ga0183373_101094 246
102 3300031548 Ga0307408_100000225 Ga0307408_10000022527 246
103 iso_pu_bacteria 2849281842 2849287005 246
104 3300013104 Ga0157370_10010782 Ga0157370_100107826 252
105 iso_pu_bacteria 2739367663 2739644470 252
106 iso_pu_bacteria 2904445276 2904447542 252
107 iso_pu_bacteria 2954016120 2954018414 252
108 3300003781 Ga0055536_1000008 Ga0055536_1000008266 253
109 3300003791 Ga0055530_10011274 Ga0055530_100112743 253
110 3300013104 Ga0157370_10003516 Ga0157370_100035168 253
111 3300025292 Ga0209676_1000042 Ga0209676_1000042262 253
112 3300025298 Ga0209050_1000035 Ga0209050_1000035261 253
113 3300031911 Ga0307412_10188890 Ga0307412_101888902 253
114 3300031995 Ga0307409_100061809 Ga0307409_1000618092 253
115 3300032002 Ga0307416_100000009 Ga0307416_100000009152 253
116 3300032004 Ga0307414_10000862 Ga0307414_100008628 253
117 3300046512 Ga0495610_0000149 Ga0495610_0000149_59422_60210 253
118 2162886007 SwRhRL2b_contig_1596339 SwRhRL2b_0713.00000780 254
119 3300005289 Ga0065704_10070168 Ga0065704_1007016879 254

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd5-assembly1.cif.gz_A structural basis for budding by the escrtiii factor chmp3 0.8991 57 147
4ijj-assembly1.cif.gz_A structure of transcription factor dksa2 from pseudomonas aeruginosa 0.8868 62 140
5h3w-assembly1.cif.gz_B the structure of the c-terminal of the fibronectin/fibrinogen-binding protein from streptococcus suis (fbps) 0.6937 60 152
4hr1-assembly1.cif.gz_A structure of pav1-137, a protein from the virus pav1 that infects pyrococcus abyssi. 0.6332 134 249
3na7-assembly1.cif.gz_A 2.2 angstrom structure of the hp0958 protein from helicobacter pylori ccug 17874 0.6192 57 225
ID Description Score Start End Superfamily
4ijjA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.8868 62 140 1.20.120.910
af_B4FRC4_1_111_1.10.287.40 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.794 57 143 1.10.287.40
1l8dA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.7938 57 147 1.10.287.510
3txqK01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.7888 69 138 1.10.287.1060
1setB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.7483 58 143 1.10.287.40
ID Description Score Start End GO Terms
AF-A0A7Y7L812-F1-model_v4 Uncharacterized protein 0.9683 129 253
AF-A0A7Y7L812-F1-model_v4 Uncharacterized protein 0.9534 129 253
AF-A0A015S2L4-F1-model_v4 deleted 0.9296 133 254
AF-A0A0F5IZV6-F1-model_v4 Conjugative transposon protein TraI 0.9234 124 254
AF-K5ZR32-F1-model_v4 Conjugative transposon protein TraI 0.9128 117 254

Feature Viewer

pLDDT pTM Quality
67.86 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map