F101458

General Info

Members Datasets Scaffolds Average Seq Length
119 101 238 322

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10057075|Ga0105245_100570754
Length 349
Sequence MAGGGSIALRHTEEEGWLLMGIPATMRALQQTSHNGPQDMRLVTDAPVPSPAAGEVLLRVAAAGVNFADLSKARGTFRDGPRPPYLAGFEAAGEIVAVGGAVIGAQPRAHVVGVGSGAFAEYVVLPAAAAMPVPPGWTDRQALGLVVNWPTALAALRHLGGVTEGQTVLVHAAAGATGQAAVMVAKHVGAAVIATASPDKHETVTASGADHVLDSRRADIAAEVLRLTGGAGVDVVLESAGGATFEASLAAAKRVTGRVVVTGLAGGRAPITNWDLVYRHQVHVIGFNLGVLIEAAPQVFGAVMVELSTLVAAGVLAPGRPTVYDLADGPKALAELESRSTVGKLALVP

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
55 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
56 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
57 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
58 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
62 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
65 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
66 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
67 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
68 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
69 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
76 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
77 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
79 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
80 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
81 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
82 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
83 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
84 2643221662 Devosia sp. Root413D1 Isolate Unclassified
85 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
86 2687453737 Frankia sp. BMG5.36 Isolate Nodule
87 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
88 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
89 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
90 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
91 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
92 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
93 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
94 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
95 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
96 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
97 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
98 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
99 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
100 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
101 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.03
Metatranscriptomes 0
Isolates 15.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0.84
Rhizoplane 1.68
Rhizosphere 84.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10057075 3300009098 Bacteria 3511
2 rootH1_10184983 3300003323 Bacteria 2383
3 rootH1_10306647 3300003323 Bacteria 3287
4 Ga0070658_10025260 3300005327 Bacteria 4763
5 Ga0070683_100203469 3300005329 Bacteria 1880
6 Ga0070682_100019884 3300005337 Bacteria 3944
7 Ga0068868_100297031 3300005338 Bacteria 1371
8 Ga0070689_100144698 3300005340 Bacteria 1914
9 Ga0070661_100219878 3300005344 Bacteria 1457
10 Ga0070668_100048250 3300005347 Bacteria 3274
11 Ga0070675_100186488 3300005354 Bacteria 1795
12 Ga0070674_100243827 3300005356 Bacteria 1408
13 Ga0070688_100195620 3300005365 Bacteria 1411
14 Ga0070714_100145729 3300005435 Bacteria 2130
15 Ga0070714_100186877 3300005435 Bacteria 1888
16 Ga0070711_100101957 3300005439 Bacteria 2089
17 Ga0068853_100004253 3300005539 Bacteria 11053
18 Ga0070665_100127880 3300005548 Bacteria 2543
19 Ga0068854_100163980 3300005578 Bacteria 1724
20 Ga0068856_100040287 3300005614 Bacteria 4587
21 Ga0070702_100019471 3300005615 Bacteria 3542
22 Ga0068861_100166335 3300005719 Bacteria 1824
23 Ga0068863_100008821 3300005841 Bacteria 9848
24 Ga0068863_100247702 3300005841 Bacteria 1721
25 Ga0081539_10004076 3300005985 Bacteria 16710
26 Ga0070717_10394294 3300006028 Bacteria 1243
27 Ga0075365_10185984 3300006038 Bacteria 1453
28 Ga0075428_100042133 3300006844 Bacteria 5021
29 Ga0075429_100003528 3300006880 Bacteria 13326
30 Ga0068865_100040058 3300006881 Bacteria 3182
31 Ga0105242_10036233 3300009176 Bacteria 3957
32 Ga0105237_10098596 3300009545 Bacteria 2913
33 Ga0105249_10334281 3300009553 Bacteria 1530
34 Ga0105239_10136554 3300010375 Bacteria 2730
35 Ga0157369_10238378 3300013105 Bacteria 1900
36 Ga0157374_10026225 3300013296 Bacteria 5243
37 Ga0157372_10442793 3300013307 Bacteria 1514
38 Ga0157372_10796486 3300013307 Bacteria 1098
39 Ga0207688_10026508 3300025901 Bacteria 3187
40 Ga0207643_10041931 3300025908 Bacteria 2580
41 Ga0207705_10308933 3300025909 Bacteria 1214
42 Ga0207693_10086527 3300025915 Bacteria 2456
43 Ga0207657_10030512 3300025919 Bacteria 4893
44 Ga0207681_10059293 3300025923 Bacteria 2624
45 Ga0207664_10188804 3300025929 Bacteria 1773
46 Ga0207669_10234550 3300025937 Bacteria 1356
47 Ga0207704_10048170 3300025938 Bacteria 2553
48 Ga0207689_10014938 3300025942 Bacteria 6588
49 Ga0207661_10092943 3300025944 Bacteria 2516
50 Ga0207658_10260541 3300025986 Bacteria 1478
51 Ga0207678_10016904 3300026067 Bacteria 6406
52 Ga0207678_10046650 3300026067 Bacteria 3746
53 Ga0207641_10001818 3300026088 Bacteria 20529
54 Ga0207674_10113960 3300026116 Bacteria 2676
55 Ga0207674_10134896 3300026116 Bacteria 2430
56 Ga0207675_100035161 3300026118 Bacteria 4674
57 Ga0207698_10014102 3300026142 Bacteria 5299
58 Ga0207698_10135448 3300026142 Bacteria 2112
59 Ga0268266_10289784 3300028379 Bacteria 1524
60 Ga0307515_10036681 3300028794 Bacteria 7921
61 Ga0307512_10014797 3300030522 Bacteria 7258
62 Ga0307518_10001304 3300031838 Bacteria 18685
63 Ga0439449_0004555 3300042007 Bacteria 5356
64 Ga0466969_0015413 3300044656 Bacteria 4007
65 Ga0466969_0043819 3300044656 Bacteria 2228
66 Ga0466972_0005102 3300044658 Bacteria 6576
67 Ga0466972_0046701 3300044658 Bacteria 2095
68 Ga0466966_0035175 3300044684 Bacteria 3238
69 Ga0466961_0029140 3300044693 Bacteria 3549
70 Ga0466961_0042685 3300044693 Bacteria 2906
71 Ga0466961_0105667 3300044693 Bacteria 1773
72 Ga0466968_0089789 3300044735 Bacteria 1360
73 Ga0466960_0021423 3300044901 Bacteria 2877
74 Ga0466967_0007175 3300045976 Bacteria 8005
75 Ga0495651_0001863 3300046462 Bacteria 16321
76 Ga0495651_0003433 3300046462 Bacteria 12159
77 Ga0495628_0003037 3300046516 Bacteria 15035
78 Ga0495628_0098267 3300046516 Bacteria 2261
79 Ga0495652_0001145 3300046529 Bacteria 29823
80 Ga0495652_0001490 3300046529 Bacteria 25807
81 Ga0495645_0006210 3300046543 Bacteria 8275
82 Ga0495645_0050894 3300046543 Bacteria 3014
83 Ga0495600_0009574 3300046809 Bacteria 5991
84 Ga0495600_0065703 3300046809 Bacteria 2372
85 Ga0495604_0008713 3300047317 Bacteria 8020
86 Ga0496108_0141225 3300048911 Bacteria 2075
87 Ga0496115_0043398 3300048918 Bacteria 3586
88 Ga0501038_0002598 3300049574 Bacteria 16869
89 Ga0501046_0053699 3300049580 Bacteria 3172
90 Ga0501047_0243709 3300049581 Bacteria 1647
91 Ga0501070_0350245 3300049586 Bacteria 1199
92 Ga0501073_0029251 3300049589 Bacteria 3937
93 Ga0501035_0004734 3300049822 Bacteria 12919
94 Ga0501044_0023587 3300049823 Bacteria 6543
95 nmdc:mga09592_28590_c1 3300050508 Bacteria 4632
96 nmdc:mga0qj67_45315_c1 3300050509 Bacteria 3470
97 nmdc:mga0qj67_7037_c1 3300050509 Bacteria 8293
98 nmdc:mga06r32_5753_c1 3300050510 Bacteria 11171
99 Ga0495601_0025494 3300053077 Bacteria 3647
100 Ga0466962_0094552 3300061719 Bacteria 1433
101 2644348578 2643221662 Bacteria 5851492
102 2676488641 2675903060 Bacteria 10051191
103 2689958286 2687453737 Bacteria 11203906
104 2753071481 2751185734 Bacteria 8863695
105 2791914323 2791354901 Bacteria 8322202
106 2791916619 2791354901 Bacteria 8322202
107 2795781828 2795385470 Bacteria 8317180
108 2812360584 2811994879 Bacteria 9313447
109 2832008245 2832004796 Bacteria 6538017
110 2861523294 2861520306 Bacteria 8348283
111 2862709229 2862705112 Bacteria 6563286
112 2863412323 2863404153 Bacteria 9672205
113 2866067918 2866065130 Bacteria 6518152
114 2891401813 2891395885 Bacteria 9251614
115 2947232948 2947224130 Bacteria 9938529
116 2997457080 2997451912 Bacteria 8492419
117 8008486659 8008485437 Bacteria 7198341
118 8025526050 8025524527 Bacteria 7197316
119 8055176282 8055172936 Bacteria 9305943
120 Ga0105245_10057075
121 rootH1_10184983
122 rootH1_10306647
123 Ga0070658_10025260
124 Ga0070683_100203469
125 Ga0070682_100019884
126 Ga0068868_100297031
127 Ga0070689_100144698
128 Ga0070661_100219878
129 Ga0070668_100048250
130 Ga0070675_100186488
131 Ga0070674_100243827
132 Ga0070688_100195620
133 Ga0070714_100145729
134 Ga0070714_100186877
135 Ga0070711_100101957
136 Ga0068853_100004253
137 Ga0070665_100127880
138 Ga0068854_100163980
139 Ga0068856_100040287
140 Ga0070702_100019471
141 Ga0068861_100166335
142 Ga0068863_100008821
143 Ga0068863_100247702
144 Ga0081539_10004076
145 Ga0070717_10394294
146 Ga0075365_10185984
147 Ga0075428_100042133
148 Ga0075429_100003528
149 Ga0068865_100040058
150 Ga0105242_10036233
151 Ga0105237_10098596
152 Ga0105249_10334281
153 Ga0105239_10136554
154 Ga0157369_10238378
155 Ga0157374_10026225
156 Ga0157372_10442793
157 Ga0157372_10796486
158 Ga0207688_10026508
159 Ga0207643_10041931
160 Ga0207705_10308933
161 Ga0207693_10086527
162 Ga0207657_10030512
163 Ga0207681_10059293
164 Ga0207664_10188804
165 Ga0207669_10234550
166 Ga0207704_10048170
167 Ga0207689_10014938
168 Ga0207661_10092943
169 Ga0207658_10260541
170 Ga0207678_10016904
171 Ga0207678_10046650
172 Ga0207641_10001818
173 Ga0207674_10113960
174 Ga0207674_10134896
175 Ga0207675_100035161
176 Ga0207698_10014102
177 Ga0207698_10135448
178 Ga0268266_10289784
179 Ga0307515_10036681
180 Ga0307512_10014797
181 Ga0307518_10001304
182 Ga0439449_0004555
183 Ga0466969_0015413
184 Ga0466969_0043819
185 Ga0466972_0005102
186 Ga0466972_0046701
187 Ga0466966_0035175
188 Ga0466961_0029140
189 Ga0466961_0042685
190 Ga0466961_0105667
191 Ga0466968_0089789
192 Ga0466960_0021423
193 Ga0466967_0007175
194 Ga0495651_0001863
195 Ga0495651_0003433
196 Ga0495628_0003037
197 Ga0495628_0098267
198 Ga0495652_0001145
199 Ga0495652_0001490
200 Ga0495645_0006210
201 Ga0495645_0050894
202 Ga0495600_0009574
203 Ga0495600_0065703
204 Ga0495604_0008713
205 Ga0496108_0141225
206 Ga0496115_0043398
207 Ga0501038_0002598
208 Ga0501046_0053699
209 Ga0501047_0243709
210 Ga0501070_0350245
211 Ga0501073_0029251
212 Ga0501035_0004734
213 Ga0501044_0023587
214 nmdc:mga09592_28590_c1
215 nmdc:mga0qj67_45315_c1
216 nmdc:mga0qj67_7037_c1
217 nmdc:mga06r32_5753_c1
218 Ga0495601_0025494
219 Ga0466962_0094552
220 2644348578
221 2676488641
222 2689958286
223 2753071481
224 2791914323
225 2791916619
226 2795781828
227 2812360584
228 2832008245
229 2861523294
230 2862709229
231 2863412323
232 2866067918
233 2891401813
234 2947232948
235 2997457080
236 8008486659
237 8025526050
238 8055176282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

52

135

0.93

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

176

307

0.88

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

207

347

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvu-assembly1.cif.gz_D the native structure of mycobacterial rv1454c complexed with nadph 0.9388 6 330
4rvu-assembly2.cif.gz_C the native structure of mycobacterial rv1454c complexed with nadph 0.9371 7 330
4rvu-assembly1.cif.gz_D the native structure of mycobacterial rv1454c complexed with nadph 0.936 6 330
1qor-assembly1.cif.gz_B crystal structure of escherichia coli quinone oxidoreductase complexed with nadph 0.9293 8 330
4rvu-assembly2.cif.gz_B the native structure of mycobacterial rv1454c complexed with nadph 0.9286 6 330
ID Description Score Start End Superfamily
af_P47199_9_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.954 8 122 3.90.180.10
af_A0A0P0W924_2_174_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9386 24 137 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.935 6 120 3.90.180.10
af_B0BNC9_26_350_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.933 7 329 3.90.180.10
af_P96826_2_321_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9322 9 328 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A7K3DSP5-F1-model_v4 Zinc-binding dehydrogenase 0.9822 7 330 GO:0016491
AF-A0A7K3DSP5-F1-model_v4 Zinc-binding dehydrogenase 0.9733 7 330 GO:0016491
AF-A0A1G7FJJ4-F1-model_v4 NADPH2:quinone reductase 0.9581 7 330 GO:0003960
GO:0005829
GO:0008270
GO:0035925
GO:0070402
AF-A0A1G7FJJ4-F1-model_v4 NADPH2:quinone reductase 0.9552 7 330 GO:0003960
GO:0005829
GO:0008270
GO:0035925
GO:0070402
AF-A0A7I9YXV7-F1-model_v4 Alcohol dehydrogenase 0.9528 7 330 GO:0016491

Map