F099439

General Info

Members Datasets Scaffolds Average Seq Length
118 78 110 732

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738541283|2738759461
Length 766
Sequence NVASVSFTITKQSAEITVQLNQLYLKISLVMNGLSPWALSSSSELVESQTALYKTVAGSFEFKVYRTTNSIWIVAELPNSGRAAFRAAFSPGGALKITKTTEKTQGVDLELDSETGKQRVEINFDLQQSNPVLHYTTHLKPKKDLLIPFWPKDILMNGKNGGPENTTGKIYISQEGTRTGLIYLTQTRPKSSSILYLQNLTALADYCEQTQTSCADTVGGIWPELGFSLPPAKGQPLKADKEIIINDAFVTFDEQTPEDQFAANRQFLNLLARVYLLLPRPETRYQNWPDILDKGLKDLIESPGCWSQVAGHKYFNAYVSDYATPPEIMVQLAVLLPLMDYTEWSKAELEVIKTVKKGLPSFYDPKLGTITRWLPAAEDQLRGEEEQKQPGVMDSWYLHHPLINLSRLALKGDKVAEKLFLDSMDFTIKVAHHFNYHWPVFYKMDTLEVLKAETAEGKGGEKDVAGLYTHVMLQAWELTQEKRYLKEAEKAAKTLQEYSFDIFYQANNTAFASGALLRLYKITKKQLYLELSYQCLAAILRNTQIWDCNYGHGKNFPKFFSLFPLNDAPYTAVYEEQEVFCALHDYLKHAEGLDILPSVKLLIAEYIRYLVDRAVYYYPPMLPEEMLEEKPKIGEVDPKLWIALEDLQDGWGKSGTVGQEVYGAGNAFGILPRHYMQVPGESFLIYVDYPTSGYKAIKGKDIHFSILGDERLTCRLMIVKTGMTKLPAFKIAVKGDKNHLNGISVANGHLEYQLNGNTQVNINWKH

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2739367656 Pedobacter sp. CF523 Isolate Unclassified
4 2818991437 Pedobacter terrae 518 Isolate Unclassified
5 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
43 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
45 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
67 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
68 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
69 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
70 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
71 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
72 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
73 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
74 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
75 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
76 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
77 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
78 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.53
Metatranscriptomes 0.85
Isolates 7.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.47
Nodule 0
Rhizoplane 0.85
Rhizosphere 75.42
Stem 0
Stem Tuber 0
Unclassified 15.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10004294 3300001990 Bacteria 4978
2 JGI24735J21928_10000001 3300002067 Bacteria 650042
3 JGI25162J39368_1000046 3300002737 Bacteria 169695
4 JGI25162J39368_1000776 3300002737 Bacteria 21475
5 JGI25165J46597_1000914 3300003214 Bacteria 20457
6 rootH1_10011835 3300003316 Bacteria 41523
7 rootH1_10011835 3300003323 Bacteria 10028
8 rootH2_10145513 3300003320 Bacteria 6586
9 rootH2_10162511 3300003320 Unclassified 4435
10 rootL2_10070600 3300003322 Bacteria 10655
11 rootL2_10075801 3300003322 Bacteria 8422
12 rootL2_10182301 3300003322 Bacteria 6435
13 Ga0065714_10002245 3300005288 Bacteria 36818
14 Ga0065714_10064427 3300005288 Bacteria 167245
15 Ga0065714_10064465 3300005288 Bacteria 65208
16 Ga0065714_10078149 3300005288 Bacteria 2624
17 Ga0070658_10039216 3300005327 Bacteria 3821
18 Ga0068868_100005902 3300005338 Bacteria 8640
19 Ga0070673_100019315 3300005364 Bacteria 4891
20 Ga0070659_100000235 3300005366 Bacteria 43031
21 Ga0070665_100000205 3300005548 Bacteria 103515
22 Ga0068855_100000035 3300005563 Bacteria 165487
23 Ga0068857_100008537 3300005577 Bacteria 8858
24 Ga0068856_100026149 3300005614 Bacteria 5691
25 Ga0068851_10004996 3300005834 Bacteria 6007
26 Ga0068858_100028198 3300005842 Bacteria 5217
27 Ga0075366_10003869 3300006195 Bacteria 7979
28 Ga0105240_10004921 3300009093 Bacteria 20082
29 Ga0105240_10078903 3300009093 Bacteria 4053
30 Ga0105237_10000146 3300009545 Bacteria 99601
31 Ga0105237_10000300 3300009545 Bacteria 68429
32 Ga0105237_10000830 3300009545 Bacteria 42322
33 Ga0105237_10002154 3300009545 Bacteria 24772
34 Ga0105239_10000053 3300010375 Bacteria 163705
35 Ga0105239_10000130 3300010375 Bacteria 105894
36 Ga0105239_10000176 3300010375 Bacteria 92577
37 Ga0157373_10000357 3300013100 Bacteria 36805
38 Ga0157371_10000441 3300013102 Bacteria 50801
39 Ga0157371_10016246 3300013102 Bacteria 5560
40 Ga0157370_10004985 3300013104 Bacteria 15021
41 Ga0157370_10019648 3300013104 Bacteria 6767
42 Ga0157369_10000004 3300013105 Bacteria 479764
43 Ga0163162_10003610 3300013306 Bacteria 14822
44 Ga0163162_10006470 3300013306 Bacteria 11341
45 Ga0163162_10012613 3300013306 Bacteria 8253
46 Ga0157372_10000735 3300013307 Bacteria 35709
47 Ga0157372_10010447 3300013307 Bacteria 9877
48 Ga0182006_1000135 3300015261 Bacteria 79175
49 Ga0182006_1000323 3300015261 Bacteria 41598
50 Ga0182007_10000006 3300015262 Bacteria 427355
51 Ga0163161_10000138 3300017792 Bacteria 68614
52 Ga0163161_10000348 3300017792 Bacteria 39127
53 Ga0206351_10141853 3300020077 Bacteria 3448
54 Ga0207427_100066 3300025231 Bacteria 165770
55 Ga0209437_100010 3300025233 Bacteria 838447
56 Ga0209437_100070 3300025233 Bacteria 306718
57 Ga0209026_1000745 3300025250 Bacteria 18591
58 Ga0209026_1005413 3300025250 Bacteria 3444
59 Ga0209233_1000017 3300025261 Bacteria 898076
60 Ga0207647_10000274 3300025904 Bacteria 41963
61 Ga0207695_10021910 3300025913 Bacteria 7273
62 Ga0207695_10062617 3300025913 Bacteria 3839
63 Ga0207671_10000634 3300025914 Bacteria 46044
64 Ga0207671_10002951 3300025914 Bacteria 17512
65 Ga0207671_10004045 3300025914 Bacteria 14219
66 Ga0207671_10009705 3300025914 Bacteria 8017
67 Ga0207690_10000279 3300025932 Bacteria 36231
68 Ga0207667_10000022 3300025949 Bacteria 369570
69 Ga0207677_10044700 3300026023 Unclassified 2953
70 Ga0207702_10000791 3300026078 Bacteria 33585
71 Ga0268266_10001358 3300028379 Bacteria 29523
72 Ga0307515_10000114 3300028794 Bacteria 194024
73 Ga0307515_10000299 3300028794 Bacteria 122087
74 Ga0307515_10000616 3300028794 Bacteria 83207
75 Ga0307412_10000009 3300031911 Bacteria 445987
76 Ga0307414_10000667 3300032004 Bacteria 17585
77 Ga0395899_0001265 3300037312 Bacteria 21971
78 Ga0395900_0001720 3300037418 Bacteria 25283
79 Ga0395900_0001991 3300037418 Bacteria 23068
80 Ga0395898_0044115 3300037466 Bacteria 4392
81 Ga0395905_0001254 3300037471 Bacteria 31416
82 Ga0395905_0002686 3300037471 Bacteria 19498
83 Ga0395901_0000861 3300038443 Bacteria 33403
84 Ga0395901_0004499 3300038443 Bacteria 14057
85 Ga0466972_0006920 3300044658 Bacteria 5689
86 Ga0495638_0018943 3300046460 Bacteria 4561
87 Ga0495650_0000013 3300046471 Bacteria 611135
88 Ga0495650_0000036 3300046471 Bacteria 400633
89 Ga0495650_0000349 3300046471 Bacteria 81735
90 Ga0495650_0020733 3300046471 Bacteria 3197
91 Ga0495606_0005453 3300046507 Bacteria 12179
92 Ga0495610_0004237 3300046512 Bacteria 10683
93 Ga0495610_0008494 3300046512 Bacteria 6639
94 Ga0495609_0011130 3300046538 Bacteria 4294
95 Ga0495668_0052728 3300046616 Bacteria 2250
96 Ga0495625_0000007 3300046660 Bacteria 565749
97 Ga0495625_0000923 3300046660 Bacteria 39492
98 Ga0495661_0000244 3300046665 Bacteria 62633
99 Ga0495661_0002399 3300046665 Bacteria 14465
100 Ga0495649_0000007 3300046694 Bacteria 518037
101 Ga0495649_0036268 3300046694 Bacteria 2709
102 Ga0495687_002020 3300047443 Bacteria 17170
103 Ga0495673_0010094 3300047469 Bacteria 5163
104 Ga0495686_0000274 3300047472 Bacteria 91650
105 Ga0495686_0000298 3300047472 Bacteria 85528
106 Ga0495686_0009550 3300047472 Bacteria 6978
107 Ga0496122_0003421 3300048925 Bacteria 20881
108 Ga0496123_0011501 3300048926 Bacteria 7667
109 nmdc:mga0k408_3026_c1 3300050493 Bacteria 8916
110 Ga0500622_0000199 3300053156 Bacteria 63518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046616 Ga0495668_0052728 Ga0495668_0052728_192_2195 663
2 3300044658 Ga0466972_0006920 Ga0466972_0006920_2635_4833 708
3 3300005288 Ga0065714_10064465 Ga0065714_1006446551 709
4 3300017792 Ga0163161_10000348 Ga0163161_1000034829 710
5 3300005338 Ga0068868_100005902 Ga0068868_10000590212 712
6 3300013104 Ga0157370_10019648 Ga0157370_100196484 712
7 3300026023 Ga0207677_10044700 Ga0207677_100447002 712
8 3300048925 Ga0496122_0003421 Ga0496122_0003421_6429_8639 712
9 3300048926 Ga0496123_0011501 Ga0496123_0011501_5033_7243 712
10 3300005834 Ga0068851_10004996 Ga0068851_100049963 713
11 3300009545 Ga0105237_10002154 Ga0105237_100021544 713
12 3300010375 Ga0105239_10000130 Ga0105239_1000013029 713
13 3300025914 Ga0207671_10004045 Ga0207671_100040458 713
14 3300005364 Ga0070673_100019315 Ga0070673_1000193152 714
15 3300005288 Ga0065714_10078149 Ga0065714_100781492 716
16 3300015261 Ga0182006_1000135 Ga0182006_10001359 716
17 3300017792 Ga0163161_10000138 Ga0163161_1000013812 716
18 3300046507 Ga0495606_0005453 Ga0495606_0005453_6617_8818 718
19 3300028794 Ga0307515_10000616 Ga0307515_1000061648 723
20 3300003320 rootH2_10145513 rootH2_101455139 724
21 3300015261 Ga0182006_1000323 Ga0182006_100032311 724
22 3300031911 Ga0307412_10000009 Ga0307412_1000000922 724
23 3300032004 Ga0307414_10000667 Ga0307414_1000066715 724
24 iso_pu_bacteria 2818991437 2819547880 724
25 3300005288 Ga0065714_10064427 Ga0065714_10064427118 725
26 3300046512 Ga0495610_0004237 Ga0495610_0004237_6945_9167 725
27 iso_pu_bacteria 2739367656 2739616640 725
28 iso_pu_bacteria 2852627209 2852630579 726
29 3300025250 Ga0209026_1000745 Ga0209026_10007452 727
30 3300037312 Ga0395899_0001265 Ga0395899_0001265_9303_11498 727
31 3300037418 Ga0395900_0001991 Ga0395900_0001991_5087_7282 727
32 3300037466 Ga0395898_0044115 Ga0395898_0044115_224_2419 727
33 3300037471 Ga0395905_0001254 Ga0395905_0001254_27094_29289 727
34 3300038443 Ga0395901_0000861 Ga0395901_0000861_27078_29273 727
35 iso_pu_bacteria 2919437846 2919439682 727
36 3300025250 Ga0209026_1005413 Ga0209026_10054132 728
37 iso_pu_bacteria 2599185184 2599477420 728
38 iso_pu_bacteria 2928078545 2928079332 728
39 iso_pu_bacteria 2928147474 2928148188 728
40 iso_pu_bacteria 2932082852 2932084075 728
41 3300002737 JGI25162J39368_1000776 JGI25162J39368_10007769 729
42 3300003214 JGI25165J46597_1000914 JGI25165J46597_100091417 729
43 3300005288 Ga0065714_10002245 Ga0065714_1000224514 729
44 3300005563 Ga0068855_100000035 Ga0068855_100000035119 729
45 3300005614 Ga0068856_100026149 Ga0068856_1000261492 729
46 3300010375 Ga0105239_10000053 Ga0105239_10000053155 729
47 3300013100 Ga0157373_10000357 Ga0157373_1000035715 729
48 3300025231 Ga0207427_100066 Ga0207427_100066136 729
49 3300025233 Ga0209437_100010 Ga0209437_100010251 729
50 3300025261 Ga0209233_1000017 Ga0209233_1000017264 729
51 3300025949 Ga0207667_10000022 Ga0207667_10000022286 729
52 3300026078 Ga0207702_10000791 Ga0207702_100007912 729
53 3300047443 Ga0495687_002020 Ga0495687_002020_6724_8925 729
54 3300005577 Ga0068857_100008537 Ga0068857_1000085374 730
55 3300005842 Ga0068858_100028198 Ga0068858_1000281983 730
56 3300013102 Ga0157371_10000441 Ga0157371_1000044118 730
57 3300013104 Ga0157370_10004985 Ga0157370_100049851 730
58 3300013105 Ga0157369_10000004 Ga0157369_10000004221 730
59 3300013306 Ga0163162_10012613 Ga0163162_100126137 730
60 3300013307 Ga0157372_10000735 Ga0157372_1000073527 730
61 3300015262 Ga0182007_10000006 Ga0182007_100000069 730
62 3300025904 Ga0207647_10000274 Ga0207647_1000027429 730
63 iso_pu_bacteria 2738541283 2738759461 730
64 3300003322 rootL2_10070600 rootL2_1007060014 731
65 3300003322 rootL2_10075801 rootL2_100758016 731
66 3300003322 rootL2_10182301 rootL2_101823015 731
67 3300005366 Ga0070659_100000235 Ga0070659_10000023519 731
68 3300009093 Ga0105240_10004921 Ga0105240_100049217 731
69 3300009093 Ga0105240_10078903 Ga0105240_100789034 731
70 3300013306 Ga0163162_10006470 Ga0163162_100064704 731
71 3300025913 Ga0207695_10021910 Ga0207695_100219103 731
72 3300025932 Ga0207690_10000279 Ga0207690_1000027919 731
73 3300028794 Ga0307515_10000114 Ga0307515_1000011474 731
74 3300046471 Ga0495650_0000036 Ga0495650_0000036_169770_171977 731
75 3300046665 Ga0495661_0000244 Ga0495661_0000244_25531_27738 731
76 3300047472 Ga0495686_0009550 Ga0495686_0009550_2102_4309 731
77 3300001990 JGI24737J22298_10004294 JGI24737J22298_100042944 732
78 3300002067 JGI24735J21928_10000001 JGI24735J21928_10000001187 732
79 3300002737 JGI25162J39368_1000046 JGI25162J39368_1000046105 732
80 3300003316 rootH1_10011835 rootH1_1001183541 732
81 3300003320 rootH2_10162511 rootH2_101625114 732
82 3300005327 Ga0070658_10039216 Ga0070658_100392164 732
83 3300005548 Ga0070665_100000205 Ga0070665_100000205108 732
84 3300006195 Ga0075366_10003869 Ga0075366_100038696 732
85 3300009545 Ga0105237_10000146 Ga0105237_1000014674 732
86 3300009545 Ga0105237_10000300 Ga0105237_1000030051 732
87 3300009545 Ga0105237_10000830 Ga0105237_1000083038 732
88 3300010375 Ga0105239_10000176 Ga0105239_1000017612 732
89 3300013102 Ga0157371_10016246 Ga0157371_100162465 732
90 3300013306 Ga0163162_10003610 Ga0163162_1000361013 732
91 3300013307 Ga0157372_10010447 Ga0157372_100104477 732
92 3300020077 Ga0206351_10141853 Ga0206351_101418534 732
93 3300025233 Ga0209437_100070 Ga0209437_100070180 732
94 3300025913 Ga0207695_10062617 Ga0207695_100626171 732
95 3300025914 Ga0207671_10000634 Ga0207671_1000063431 732
96 3300025914 Ga0207671_10002951 Ga0207671_1000295113 732
97 3300025914 Ga0207671_10009705 Ga0207671_100097055 732
98 3300028379 Ga0268266_10001358 Ga0268266_1000135818 732
99 3300028794 Ga0307515_10000299 Ga0307515_10000299105 732
100 3300037418 Ga0395900_0001720 Ga0395900_0001720_9832_12039 732
101 3300037471 Ga0395905_0002686 Ga0395905_0002686_6431_8638 732
102 3300038443 Ga0395901_0004499 Ga0395901_0004499_1231_3438 732
103 3300046460 Ga0495638_0018943 Ga0495638_0018943_1738_3954 732
104 3300046471 Ga0495650_0000013 Ga0495650_0000013_152490_154700 732
105 3300046471 Ga0495650_0000349 Ga0495650_0000349_20329_22545 732
106 3300046471 Ga0495650_0020733 Ga0495650_0020733_375_2588 732
107 3300046512 Ga0495610_0008494 Ga0495610_0008494_1838_4054 732
108 3300046538 Ga0495609_0011130 Ga0495609_0011130_452_2668 732
109 3300046660 Ga0495625_0000007 Ga0495625_0000007_23007_25223 732
110 3300046660 Ga0495625_0000923 Ga0495625_0000923_17063_19279 732
111 3300046665 Ga0495661_0002399 Ga0495661_0002399_11441_13657 732
112 3300046694 Ga0495649_0000007 Ga0495649_0000007_410409_412625 732
113 3300046694 Ga0495649_0036268 Ga0495649_0036268_431_2641 732
114 3300047469 Ga0495673_0010094 Ga0495673_0010094_13_2229 732
115 3300047472 Ga0495686_0000274 Ga0495686_0000274_48291_50507 732
116 3300047472 Ga0495686_0000298 Ga0495686_0000298_33788_36013 732
117 3300050493 nmdc:mga0k408_3026_c1 nmdc:mga0k408_3026_c1_72_2279 732
118 3300053156 Ga0500622_0000199 Ga0500622_0000199_10334_12607 732

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v1s-assembly1.cif.gz_A structure of the gh76 alpha-mannanase bt2949 from bacteroides thetaiotaomicron 0.6652 253 642
6shm-assembly1.cif.gz_A an inactive (d136a and d137a) variant of alpha-1,6-mannanase, gh76a of salegentibacter sp. hel1_6 in complex with alpha-1,6-mannotetrose 0.6473 255 641
4v1s-assembly1.cif.gz_A structure of the gh76 alpha-mannanase bt2949 from bacteroides thetaiotaomicron 0.6415 253 642
6shd-assembly3.cif.gz_C structure of the gh76a alpha-1,6-mannanase from salegentibacter sp. hel1_6 0.6399 257 641
6shm-assembly1.cif.gz_A an inactive (d136a and d137a) variant of alpha-1,6-mannanase, gh76a of salegentibacter sp. hel1_6 in complex with alpha-1,6-mannotetrose 0.636 255 641
ID Description Score Start End Superfamily
af_Q4CZF5_1_150_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.6711 19 54 3.30.450.30
af_Q65Z14_150_232_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6711 681 731 2.60.40.10
af_Q4D223_1_256_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.6698 302 463 1.50.10.10
af_Q99650_150_234_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6528 682 731 2.60.40.10
af_A0A1D8PIJ7_44_397_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.636 325 597 1.50.10.20
ID Description Score Start End GO Terms
AF-A0A6H2BJ64-F1-model_v4 deleted 0.987 1 732
AF-A0A6H2BJ64-F1-model_v4 deleted 0.9857 1 732
AF-A0A520J0U8-F1-model_v4 Alpha-L-rhamnosidase six-hairpin glycosidase domain-containing protein 0.9817 1 732 GO:0005975
AF-A0A1T5DBV3-F1-model_v4 Uncharacterized protein 0.9813 2 731 GO:0005975
AF-A0A520J0U8-F1-model_v4 Alpha-L-rhamnosidase six-hairpin glycosidase domain-containing protein 0.9804 1 732 GO:0005975

Feature Viewer

pLDDT pTM Quality
91.78 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map