F098501

General Info

Members Datasets Scaffolds Average Seq Length
118 77 236 287

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0023297|Ga0453684_0023297_2729_3658
Length 309
Sequence MANLRLIKRRIKSAKNISQVTKALEMVSAVKMRKAQETAMAGKPYANELKRVLLELGGKVEKDLHPFLNPVTEVNKVMVVVIGSEKGLAGALVTNLARKVFSIQQQIENGKLILDDQNEGEAISVSRNAKVTAVSWGKKAREILKKTGWQIVADFSTKTGEPLEDMIRALDNLTSTSYLTRGSDLVIVVYANFVNTMTQKPAAIQFLPMTAQQIAGAESNHVSSAIVNFEPSPAAVLDSLLTHYLKTILTQIIFDSLAAEHSARMVAMKNANENASDIIKGLTASYNETRQAAITNEIADIVSGSMIAV

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
12 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
13 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
21 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
22 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
27 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
28 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
29 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
30 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
31 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
34 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
35 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
38 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
39 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
40 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
41 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
42 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
43 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
44 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
45 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
46 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
47 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
48 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
49 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
50 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
51 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
52 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
55 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
56 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
57 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
58 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
59 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
60 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
61 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
62 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
63 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
64 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
65 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
66 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
72 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
73 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
74 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
75 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
76 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
77 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.46
Metatranscriptomes 2.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.15
Stem 0
Stem Tuber 0
Unclassified 3.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0023297 3300044712 Bacteria 9132
2 rootL2_10171718 3300003322 Bacteria 1589
3 Ga0058863_10005210 3300004799 Bacteria 4154
4 Ga0070683_100012476 3300005329 Bacteria 7384
5 Ga0068868_100467173 3300005338 Bacteria 1100
6 Ga0070714_100153848 3300005435 Bacteria 2075
7 Ga0070700_100193078 3300005441 Bacteria 1425
8 Ga0070707_100001353 3300005468 Bacteria 24080
9 Ga0070704_100222300 3300005549 Bacteria 1536
10 Ga0068859_100175708 3300005617 Bacteria 2223
11 Ga0097621_100143463 3300006237 Bacteria 2042
12 Ga0097620_100175725 3300006931 Bacteria 2223
13 Ga0075435_100222036 3300007076 Unclassified 1604
14 Ga0105240_10001350 3300009093 Bacteria 42116
15 Ga0105240_10259286 3300009093 Bacteria 2006
16 Ga0111539_10144020 3300009094 Bacteria 2790
17 Ga0105245_10221806 3300009098 Bacteria 1825
18 Ga0114129_10131407 3300009147 Bacteria 3438
19 Ga0114129_10278046 3300009147 Bacteria 2238
20 Ga0114129_10457641 3300009147 Bacteria 1672
21 Ga0105241_10310166 3300009174 Unclassified 1357
22 Ga0105242_10450808 3300009176 Viruses 1213
23 Ga0163163_10000098 3300014325 Bacteria 91630
24 Ga0163163_10148517 3300014325 Bacteria 2388
25 Ga0163163_10452022 3300014325 Unclassified 1345
26 Ga0157376_10013760 3300014969 Bacteria 6050
27 Ga0206350_10846079 3300020080 Bacteria 1953
28 Ga0224712_10000910 3300022467 Bacteria 6372
29 Ga0207695_10070501 3300025913 Bacteria 3573
30 Ga0207661_10013817 3300025944 Bacteria 5902
31 Ga0265337_1000338 3300028556 Bacteria 25034
32 Ga0265337_1002719 3300028556 Bacteria 7936
33 Ga0265319_1020215 3300028563 Bacteria 2473
34 Ga0265334_10002678 3300028573 Bacteria 8226
35 Ga0265334_10082203 3300028573 Unclassified 1185
36 Ga0265323_10000064 3300028653 Bacteria 57250
37 Ga0265323_10001861 3300028653 Bacteria 9980
38 Ga0265323_10005317 3300028653 Bacteria 5471
39 Ga0265323_10009135 3300028653 Bacteria 4066
40 Ga0265323_10010484 3300028653 Bacteria 3756
41 Ga0265322_10001505 3300028654 Bacteria 7566
42 Ga0265336_10004087 3300028666 Bacteria 5560
43 Ga0265338_10000016 3300028800 Bacteria 347424
44 Ga0265338_10000382 3300028800 Bacteria 79298
45 Ga0265338_10003191 3300028800 Bacteria 23379
46 Ga0265338_10011197 3300028800 Bacteria 10396
47 Ga0265338_10038567 3300028800 Bacteria 4523
48 Ga0265338_10090034 3300028800 Bacteria 2540
49 Ga0265324_10038806 3300029957 Bacteria 1651
50 Ga0265330_10040466 3300031235 Bacteria 2070
51 Ga0265330_10072848 3300031235 Bacteria 1485
52 Ga0265328_10025427 3300031239 Bacteria 2230
53 Ga0265320_10000641 3300031240 Bacteria 26751
54 Ga0265320_10001438 3300031240 Bacteria 17334
55 Ga0265329_10001590 3300031242 Bacteria 10874
56 Ga0265339_10122986 3300031249 Bacteria 1332
57 Ga0265316_10004787 3300031344 Bacteria 13352
58 Ga0265316_10085332 3300031344 Bacteria 2416
59 Ga0265316_10111690 3300031344 Bacteria 2069
60 Ga0265316_10183486 3300031344 Bacteria 1557
61 Ga0265316_10391929 3300031344 Bacteria 1001
62 Ga0265314_10000037 3300031711 Bacteria 225790
63 Ga0265342_10003078 3300031712 Bacteria 13940
64 Ga0265342_10054114 3300031712 Bacteria 2386
65 Ga0373926_0041479 3300035083 Bacteria 1644
66 Ga0373951_0050074 3300035091 Bacteria 1026
67 Ga0373945_0043239 3300035116 Bacteria 1634
68 Ga0373943_0028666 3300035170 Bacteria 2625
69 Ga0373946_0053188 3300035171 Bacteria 1700
70 Ga0373935_0035802 3300035692 Bacteria 3099
71 Ga0373935_0044509 3300035692 Bacteria 2797
72 Ga0373927_0013893 3300035695 Bacteria 5342
73 Ga0373947_0033739 3300035725 Bacteria 3024
74 Ga0373947_0105461 3300035725 Bacteria 1776
75 Ga0373937_0102155 3300036401 Bacteria 2662
76 Ga0373937_0645368 3300036401 Bacteria 1004
77 Ga0316584_0246177 3300036712 Bacteria 1307
78 Ga0373925_0009092 3300037068 Bacteria 7231
79 Ga0395905_0269894 3300037471 Bacteria 1587
80 Ga0451577_0009986 3300042876 Bacteria 9097
81 Ga0451577_0258708 3300042876 Bacteria 1576
82 Ga0453684_0002436 3300044712 Bacteria 45223
83 Ga0453684_0018705 3300044712 Bacteria 10613
84 Ga0453684_0018958 3300044712 Bacteria 10515
85 Ga0453684_0072404 3300044712 Bacteria 4351
86 Ga0453684_0124907 3300044712 Bacteria 3099
87 Ga0453684_0249410 3300044712 Bacteria 2039
88 Ga0451576_0000379 3300045051 Bacteria 104282
89 Ga0451576_0003625 3300045051 Bacteria 20977
90 Ga0451576_0156230 3300045051 Bacteria 2379
91 Ga0451576_0345381 3300045051 Bacteria 1558
92 Ga0451576_0710140 3300045051 Bacteria 1056
93 Ga0495641_0034884 3300046461 Bacteria 2375
94 Ga0495630_0000119 3300046517 Bacteria 62254
95 Ga0495666_0032498 3300046526 Bacteria 2553
96 Ga0495586_0000520 3300046535 Bacteria 22726
97 Ga0495586_0006266 3300046535 Bacteria 6356
98 Ga0495634_0010402 3300046642 Bacteria 6817
99 Ga0495634_0196915 3300046642 Bacteria 1253
100 Ga0495658_0016559 3300046683 Bacteria 3794
101 Ga0495613_0006445 3300046689 Bacteria 8775
102 Ga0495624_0142782 3300046690 Bacteria 1466
103 Ga0495604_0156810 3300047317 Bacteria 1612
104 Ga0495674_0000192 3300047319 Bacteria 49134
105 Ga0495676_0000717 3300047321 Bacteria 27596
106 Ga0495676_0110491 3300047321 Bacteria 2018
107 Ga0501032_0009288 3300049569 Bacteria 7125
108 Ga0501033_0001541 3300049570 Bacteria 20374
109 Ga0501036_0370195 3300049572 Bacteria 1196
110 Ga0501046_0003253 3300049580 Bacteria 14916
111 Ga0501080_0093324 3300049742 Bacteria 2795
112 Ga0501083_0031028 3300049744 Bacteria 3668
113 Ga0501044_0191338 3300049823 Bacteria 2008
114 nmdc:mga05p37_372355_c1 3300050507 Bacteria 1676
115 nmdc:mga05p37_470689_c1 3300050507 Bacteria 1450
116 nmdc:mga08y16_375785_c1 3300050511 Bacteria 1457
117 nmdc:mga0n895_444794_c1 3300050512 Bacteria 1309
118 nmdc:mga0rr50_235761_c1 3300050513 Bacteria 1515
119 Ga0453684_0023297
120 rootL2_10171718
121 Ga0058863_10005210
122 Ga0070683_100012476
123 Ga0068868_100467173
124 Ga0070714_100153848
125 Ga0070700_100193078
126 Ga0070707_100001353
127 Ga0070704_100222300
128 Ga0068859_100175708
129 Ga0097621_100143463
130 Ga0097620_100175725
131 Ga0075435_100222036
132 Ga0105240_10001350
133 Ga0105240_10259286
134 Ga0111539_10144020
135 Ga0105245_10221806
136 Ga0114129_10131407
137 Ga0114129_10278046
138 Ga0114129_10457641
139 Ga0105241_10310166
140 Ga0105242_10450808
141 Ga0163163_10000098
142 Ga0163163_10148517
143 Ga0163163_10452022
144 Ga0157376_10013760
145 Ga0206350_10846079
146 Ga0224712_10000910
147 Ga0207695_10070501
148 Ga0207661_10013817
149 Ga0265337_1000338
150 Ga0265337_1002719
151 Ga0265319_1020215
152 Ga0265334_10002678
153 Ga0265334_10082203
154 Ga0265323_10000064
155 Ga0265323_10001861
156 Ga0265323_10005317
157 Ga0265323_10009135
158 Ga0265323_10010484
159 Ga0265322_10001505
160 Ga0265336_10004087
161 Ga0265338_10000016
162 Ga0265338_10000382
163 Ga0265338_10003191
164 Ga0265338_10011197
165 Ga0265338_10038567
166 Ga0265338_10090034
167 Ga0265324_10038806
168 Ga0265330_10040466
169 Ga0265330_10072848
170 Ga0265328_10025427
171 Ga0265320_10000641
172 Ga0265320_10001438
173 Ga0265329_10001590
174 Ga0265339_10122986
175 Ga0265316_10004787
176 Ga0265316_10085332
177 Ga0265316_10111690
178 Ga0265316_10183486
179 Ga0265316_10391929
180 Ga0265314_10000037
181 Ga0265342_10003078
182 Ga0265342_10054114
183 Ga0373926_0041479
184 Ga0373951_0050074
185 Ga0373945_0043239
186 Ga0373943_0028666
187 Ga0373946_0053188
188 Ga0373935_0035802
189 Ga0373935_0044509
190 Ga0373927_0013893
191 Ga0373947_0033739
192 Ga0373947_0105461
193 Ga0373937_0102155
194 Ga0373937_0645368
195 Ga0316584_0246177
196 Ga0373925_0009092
197 Ga0395905_0269894
198 Ga0451577_0009986
199 Ga0451577_0258708
200 Ga0453684_0002436
201 Ga0453684_0018705
202 Ga0453684_0018958
203 Ga0453684_0072404
204 Ga0453684_0124907
205 Ga0453684_0249410
206 Ga0451576_0000379
207 Ga0451576_0003625
208 Ga0451576_0156230
209 Ga0451576_0345381
210 Ga0451576_0710140
211 Ga0495641_0034884
212 Ga0495630_0000119
213 Ga0495666_0032498
214 Ga0495586_0000520
215 Ga0495586_0006266
216 Ga0495634_0010402
217 Ga0495634_0196915
218 Ga0495658_0016559
219 Ga0495613_0006445
220 Ga0495624_0142782
221 Ga0495604_0156810
222 Ga0495674_0000192
223 Ga0495676_0000717
224 Ga0495676_0110491
225 Ga0501032_0009288
226 Ga0501033_0001541
227 Ga0501036_0370195
228 Ga0501046_0003253
229 Ga0501080_0093324
230 Ga0501083_0031028
231 Ga0501044_0191338
232 nmdc:mga05p37_372355_c1
233 nmdc:mga05p37_470689_c1
234 nmdc:mga08y16_375785_c1
235 nmdc:mga0n895_444794_c1
236 nmdc:mga0rr50_235761_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00231

ATP-synt

ATP synthase

3

306

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vmd-assembly1.cif.gz_g chloroplast atp synthase (c1, cf1) 0.8454 1 261
8dbt-assembly1.cif.gz_G "e. coli atp synthase imaged in 10mm mgatp state2 ""down" 0.8421 2 261
7l1s-assembly1.cif.gz_G ps3 f1-atpase pi-bound dwell 0.8417 3 265
6foc-assembly1.cif.gz_G f1-atpase from mycobacterium smegmatis 0.8396 3 267
5hkk-assembly2.cif.gz_O caldalaklibacillus thermarum f1-atpase (wild type) 0.8368 3 267
ID Description Score Start End Superfamily
af_I1KY89_89_218_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8838 69 181 3.40.1380.10
1fs0G01 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8739 64 177 3.40.1380.10
af_A0A1D6QQB0_1_102_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8376 75 162 3.40.1380.10
2qe7G02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8373 64 183 3.40.1380.10
3oaaG02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8234 61 189 3.40.1380.10
ID Description Score Start End GO Terms
AF-A0A2V5IZN0-F1-model_v4 F0F1 ATP synthase subunit gamma 0.9203 1 176 GO:0045261
GO:0046933
AF-A0A7R9UIJ6-F1-model_v4 ATP synthase subunit gamma 0.912 5 177 GO:0045261
GO:0046933
AF-A0A7X8IHQ8-F1-model_v4 ATP synthase F1 subunit gamma 0.909 1 177 GO:0045261
GO:0046933
AF-A0A382F861-F1-model_v4 F0F1 ATP synthase subunit gamma 0.9057 1 184 GO:0045261
GO:0046933
AF-A0A2V5IZN0-F1-model_v4 F0F1 ATP synthase subunit gamma 0.9057 1 176 GO:0045261
GO:0046933

Map