F098486

General Info

Members Datasets Scaffolds Average Seq Length
118 82 236 207

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0279994|Ga0466963_0279994_103_813
Length 236
Sequence VTGAASGPPAGGPQVPHTPDSLVDPHHGHPPHSFDVVSSETLYEGAIFALRGDKVRMPGGRVATREKVEHFGAVAVAALDDADRLVMIYQYRPAIGRRIWEMPAGLLDGGSDEAPLEAAKRELVEEVGVTADDWSTLVDVVGCPGFADESVRVYLARGLRDVDRPAVADDEEADLVIRRVPLPDLVTGAMSGDLVNGPCIAGVFAAAEVVAGRFTPRPVDAPWVDRPTDYARRRQG

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
8 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
11 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
12 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
13 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
14 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
15 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
16 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
17 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
18 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
26 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
27 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
28 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
29 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
30 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
31 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
32 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
33 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
34 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
35 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
36 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
37 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
38 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
39 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
40 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
41 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
42 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
43 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
44 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
45 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
46 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
47 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
48 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
49 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
50 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
51 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
52 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
53 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
54 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
55 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
56 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
63 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
64 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
65 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
66 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
67 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
68 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
69 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
70 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
71 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
72 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
73 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
74 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
75 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
76 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
77 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
78 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
79 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
80 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
81 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
82 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.92
Metatranscriptomes 0
Isolates 5.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.39
Nodule 0.85
Rhizoplane 5.93
Rhizosphere 77.97
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0279994 3300044694 Unclassified 1172
2 JGI24735J21928_10025146 3300002067 Bacteria 1798
3 Ga0070666_10001373 3300005335 Bacteria 14782
4 Ga0070668_100023644 3300005347 Bacteria 4650
5 Ga0070667_100030207 3300005367 Bacteria 4519
6 Ga0070665_100003227 3300005548 Bacteria 17526
7 Ga0068863_100002679 3300005841 Bacteria 17599
8 Ga0068860_100000035 3300005843 Bacteria 238993
9 Ga0081455_10000023 3300005937 Bacteria 159570
10 Ga0070712_100330443 3300006175 Bacteria 1242
11 Ga0075369_10013426 3300006186 Bacteria 3252
12 Ga0105247_10171991 3300009101 Bacteria 1441
13 Ga0105249_10147020 3300009553 Bacteria 2265
14 Ga0157379_10050190 3300014968 Bacteria 3724
15 Ga0213873_10000070 3300021358 Bacteria 22036
16 Ga0213876_10080952 3300021384 Bacteria 1717
17 Ga0213875_10002885 3300021388 Bacteria 10049
18 Ga0213875_10014610 3300021388 Bacteria 3829
19 Ga0207680_10002097 3300025903 Bacteria 9343
20 Ga0207664_10292289 3300025929 Bacteria 1432
21 Ga0207668_10127466 3300025972 Bacteria 1938
22 Ga0207658_10135926 3300025986 Bacteria 1982
23 Ga0207641_10003155 3300026088 Bacteria 14770
24 Ga0268266_10004214 3300028379 Bacteria 13844
25 Ga0268266_10442334 3300028379 Bacteria 1235
26 Ga0268264_10000031 3300028381 Bacteria 409525
27 Ga0316576_10019017 3300031727 Bacteria 4700
28 Ga0316574_0026156 3300035398 Bacteria 3508
29 Ga0395900_0129505 3300037418 Bacteria 2587
30 Ga0436364_0837475 3300037853 Bacteria 10345
31 Ga0436364_1392687 3300037853 Bacteria 12150
32 Ga0395901_0052095 3300038443 Bacteria 4254
33 Ga0436365_1467507 3300039437 Bacteria 1919
34 Ga0436365_1664021 3300039437 Bacteria 8421
35 Ga0436363_1514898 3300039450 Bacteria 868
36 Ga0436362_0052690 3300039453 Bacteria 15510
37 Ga0436362_1179520 3300039453 Unclassified 650
38 Ga0466972_0024085 3300044658 Bacteria 3022
39 Ga0466972_0132602 3300044658 Bacteria 1173
40 Ga0466965_0006682 3300044683 Bacteria 5258
41 Ga0466965_0023356 3300044683 Bacteria 2986
42 Ga0466965_0031183 3300044683 Bacteria 2599
43 Ga0466966_0009943 3300044684 Bacteria 6306
44 Ga0466961_0046288 3300044693 Bacteria 2783
45 Ga0466961_0250013 3300044693 Bacteria 1089
46 Ga0466963_0003828 3300044694 Bacteria 8678
47 Ga0466963_0133978 3300044694 Bacteria 1713
48 Ga0466963_0283140 3300044694 Bacteria 1165
49 Ga0466964_0004915 3300044706 Bacteria 4942
50 Ga0466971_0028897 3300044719 Bacteria 2479
51 Ga0466970_0015608 3300044765 Bacteria 3909
52 Ga0466970_0104552 3300044765 Bacteria 1544
53 Ga0466970_0273375 3300044765 Bacteria 949
54 Ga0466957_0003536 3300044842 Bacteria 8600
55 Ga0466957_0089040 3300044842 Bacteria 1932
56 Ga0466960_0000613 3300044901 Bacteria 12306
57 Ga0466960_0014552 3300044901 Bacteria 3372
58 Ga0466960_0047803 3300044901 Bacteria 2053
59 Ga0466959_0010561 3300045049 Bacteria 6609
60 Ga0466959_0184198 3300045049 Bacteria 1460
61 Ga0466959_0271596 3300045049 Bacteria 1165
62 Ga0466958_0312920 3300045836 Bacteria 1009
63 Ga0466967_0093581 3300045976 Bacteria 2735
64 Ga0466967_0172797 3300045976 Bacteria 2034
65 Ga0466967_0285430 3300045976 Bacteria 1584
66 Ga0466967_0697042 3300045976 Bacteria 1006
67 Ga0466967_1143465 3300045976 Bacteria 776
68 Ga0495582_0231021 3300046473 Bacteria 1059
69 Ga0496102_0139570 3300048905 Bacteria 2272
70 Ga0496102_1083755 3300048905 Bacteria 721
71 Ga0496109_0404762 3300048912 Bacteria 1289
72 Ga0496110_0259611 3300048913 Bacteria 1581
73 Ga0496111_0392159 3300048914 Bacteria 1026
74 Ga0496114_0239506 3300048917 Bacteria 1595
75 Ga0496114_0965464 3300048917 Bacteria 735
76 Ga0496118_0103067 3300048921 Bacteria 1921
77 Ga0496121_0045431 3300048924 Bacteria 3774
78 Ga0496126_0000006 3300048929 Bacteria 798804
79 Ga0501033_0085969 3300049570 Bacteria 2303
80 Ga0501034_0010773 3300049571 Bacteria 9497
81 Ga0501034_0464729 3300049571 Bacteria 1182
82 Ga0501036_0010863 3300049572 Bacteria 7522
83 Ga0501037_0000760 3300049573 Bacteria 24310
84 Ga0501038_0013398 3300049574 Bacteria 7474
85 Ga0501039_0001899 3300049575 Bacteria 15452
86 Ga0501043_0004597 3300049579 Bacteria 11195
87 Ga0501043_0246122 3300049579 Bacteria 1378
88 Ga0501047_0935383 3300049581 Bacteria 680
89 Ga0501070_0001732 3300049586 Bacteria 19288
90 Ga0501070_0002173 3300049586 Bacteria 17247
91 Ga0501070_0038775 3300049586 Bacteria 3975
92 Ga0501070_0053213 3300049586 Bacteria 3359
93 Ga0501070_0242220 3300049586 Bacteria 1476
94 Ga0501073_0010991 3300049589 Bacteria 6621
95 Ga0501073_0300047 3300049589 Bacteria 1108
96 Ga0501074_0001467 3300049590 Bacteria 15840
97 Ga0501077_0429526 3300049593 Bacteria 845
98 Ga0501079_0003473 3300049741 Bacteria 11587
99 Ga0501079_0280521 3300049741 Bacteria 1303
100 Ga0501080_0002150 3300049742 Bacteria 17115
101 Ga0501080_0023520 3300049742 Bacteria 5710
102 Ga0501080_0067195 3300049742 Bacteria 3334
103 Ga0501080_0198822 3300049742 Bacteria 1841
104 Ga0501044_0013542 3300049823 Bacteria 8815
105 nmdc:mga06r32_198_c1 3300050510 Bacteria 26154
106 Ga0495595_0388376 3300053084 Bacteria 707
107 Ga0495619_0251625 3300053085 Unclassified 1224
108 Ga0500559_0023606 3300053136 Bacteria 2611
109 Ga0500568_0006046 3300053139 Bacteria 6144
110 Ga0500616_0124657 3300053153 Bacteria 1225
111 Ga0501084_0411712 3300054114 Bacteria 1143
112 Ga0466962_0034102 3300061719 Bacteria 2435
113 2744957649 2744054611 Bacteria 5611514
114 2837269767 2837268691 Bacteria 7850704
115 2842140441 2842134933 Bacteria 5847019
116 2866556579 2866552031 Bacteria 5824618
117 2868093150 2868088558 Bacteria 7609351
118 2897563736 2897561785 Bacteria 3256946
119 Ga0466963_0279994
120 JGI24735J21928_10025146
121 Ga0070666_10001373
122 Ga0070668_100023644
123 Ga0070667_100030207
124 Ga0070665_100003227
125 Ga0068863_100002679
126 Ga0068860_100000035
127 Ga0081455_10000023
128 Ga0070712_100330443
129 Ga0075369_10013426
130 Ga0105247_10171991
131 Ga0105249_10147020
132 Ga0157379_10050190
133 Ga0213873_10000070
134 Ga0213876_10080952
135 Ga0213875_10002885
136 Ga0213875_10014610
137 Ga0207680_10002097
138 Ga0207664_10292289
139 Ga0207668_10127466
140 Ga0207658_10135926
141 Ga0207641_10003155
142 Ga0268266_10004214
143 Ga0268266_10442334
144 Ga0268264_10000031
145 Ga0316576_10019017
146 Ga0316574_0026156
147 Ga0395900_0129505
148 Ga0436364_0837475
149 Ga0436364_1392687
150 Ga0395901_0052095
151 Ga0436365_1467507
152 Ga0436365_1664021
153 Ga0436363_1514898
154 Ga0436362_0052690
155 Ga0436362_1179520
156 Ga0466972_0024085
157 Ga0466972_0132602
158 Ga0466965_0006682
159 Ga0466965_0023356
160 Ga0466965_0031183
161 Ga0466966_0009943
162 Ga0466961_0046288
163 Ga0466961_0250013
164 Ga0466963_0003828
165 Ga0466963_0133978
166 Ga0466963_0283140
167 Ga0466964_0004915
168 Ga0466971_0028897
169 Ga0466970_0015608
170 Ga0466970_0104552
171 Ga0466970_0273375
172 Ga0466957_0003536
173 Ga0466957_0089040
174 Ga0466960_0000613
175 Ga0466960_0014552
176 Ga0466960_0047803
177 Ga0466959_0010561
178 Ga0466959_0184198
179 Ga0466959_0271596
180 Ga0466958_0312920
181 Ga0466967_0093581
182 Ga0466967_0172797
183 Ga0466967_0285430
184 Ga0466967_0697042
185 Ga0466967_1143465
186 Ga0495582_0231021
187 Ga0496102_0139570
188 Ga0496102_1083755
189 Ga0496109_0404762
190 Ga0496110_0259611
191 Ga0496111_0392159
192 Ga0496114_0239506
193 Ga0496114_0965464
194 Ga0496118_0103067
195 Ga0496121_0045431
196 Ga0496126_0000006
197 Ga0501033_0085969
198 Ga0501034_0010773
199 Ga0501034_0464729
200 Ga0501036_0010863
201 Ga0501037_0000760
202 Ga0501038_0013398
203 Ga0501039_0001899
204 Ga0501043_0004597
205 Ga0501043_0246122
206 Ga0501047_0935383
207 Ga0501070_0001732
208 Ga0501070_0002173
209 Ga0501070_0038775
210 Ga0501070_0053213
211 Ga0501070_0242220
212 Ga0501073_0010991
213 Ga0501073_0300047
214 Ga0501074_0001467
215 Ga0501077_0429526
216 Ga0501079_0003473
217 Ga0501079_0280521
218 Ga0501080_0002150
219 Ga0501080_0023520
220 Ga0501080_0067195
221 Ga0501080_0198822
222 Ga0501044_0013542
223 nmdc:mga06r32_198_c1
224 Ga0495595_0388376
225 Ga0495619_0251625
226 Ga0500559_0023606
227 Ga0500568_0006046
228 Ga0500616_0124657
229 Ga0501084_0411712
230 Ga0466962_0034102
231 2744957649
232 2837269767
233 2842140441
234 2866556579
235 2868093150
236 2897563736

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

68

197

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mqw-assembly1.cif.gz_A-2 structure of the mt-adprase in complex with three mn2+ ions and ampcpr, a nudix enzyme 0.9681 6 202
5i8u-assembly2.cif.gz_A crystal structure of the rv1700 (mt adprase) e142q mutant 0.9442 6 202
1mk1-assembly1.cif.gz_A structure of the mt-adprase in complex with adpr, a nudix enzyme 0.9431 7 202
1mqw-assembly1.cif.gz_A-2 structure of the mt-adprase in complex with three mn2+ ions and ampcpr, a nudix enzyme 0.9303 6 202
5i8u-assembly2.cif.gz_B crystal structure of the rv1700 (mt adprase) e142q mutant 0.9278 7 202
ID Description Score Start End Superfamily
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9497 7 182 3.90.79.10
5i8uB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9278 7 202 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9185 7 182 3.90.79.10
2w4eB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9156 46 187 3.90.79.10
2w4eB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8827 46 187 3.90.79.10
ID Description Score Start End GO Terms
AF-F8AV43-F1-model_v4 NUDIX hydrolase 0.9886 7 202 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-A0A2W1S964-F1-model_v4 deleted 0.9846 38 185
AF-A0A1S1EL05-F1-model_v4 ADP-ribose pyrophosphatase 0.9823 7 202 GO:0005829
GO:0006753
GO:0019693
AF-A0A2R4FVZ2-F1-model_v4 ADP-ribose pyrophosphatase 0.9808 30 199 GO:0005829
GO:0006753
GO:0019693
AF-E3IX61-F1-model_v4 NUDIX hydrolase 0.9807 6 200 GO:0005829
GO:0006753
GO:0016787
GO:0019693

Map