F097981

General Info

Members Datasets Scaffolds Average Seq Length
118 93 236 302

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10000691|Ga0265314_1000069124
Length 299
Sequence MPEFPDVTIYIEALEARVRGQKLERIRIASPFLIRSVEPPIFEAEKKTVLGLRRLGKRIVFELEGGLFLILHLMIAGRMRWQEEKGAKIPAKLGLAAFDFPNGTLLLTEASSKKRASLHLVRGSELLARHDPGGLEVFACSEREFSEALRRENRMLKRALADPKLFSGIGNAYSDEILHAAKLSPVTLTGKLTDAEIARLFKAVKATLIHWTDELRREFAGRFPGAGEITAFRPGFAMHGRFGQPCPVCKTSVQRIRYAENETNYCPRCQTKGKLLADRSLSRLLKNDWPKTIEEWEEE

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
39 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
48 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
49 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
50 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
51 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
52 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
53 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
54 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
55 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
56 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
57 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
58 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
59 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
60 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
61 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
62 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
63 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
64 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
65 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
66 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
67 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
68 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
71 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
75 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
76 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
77 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
78 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
79 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
80 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
81 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
82 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
83 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
84 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
85 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
86 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
87 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
88 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
89 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
90 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
91 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
92 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
93 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.39
Rhizosphere 96.61
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10000691 3300031711 Bacteria 40948
2 JGI25406J46586_10000388 3300003203 Bacteria 20211
3 JGI25406J46586_10000666 3300003203 Bacteria 15995
4 JGI25406J46586_10006698 3300003203 Bacteria 5293
5 Ga0070658_10221809 3300005327 Bacteria 1599
6 Ga0070667_100228995 3300005367 Bacteria 1657
7 Ga0070709_10000014 3300005434 Bacteria 158503
8 Ga0070694_100000113 3300005444 Bacteria 39193
9 Ga0070708_100091987 3300005445 Bacteria 2763
10 Ga0070662_100108697 3300005457 Bacteria 2109
11 Ga0070699_100000558 3300005518 Bacteria 35133
12 Ga0070699_100049514 3300005518 Bacteria 3637
13 Ga0070699_100237187 3300005518 Bacteria 1627
14 Ga0070697_100364102 3300005536 Bacteria 1250
15 Ga0070704_100058385 3300005549 Bacteria 2748
16 Ga0068861_100131505 3300005719 Bacteria 2032
17 Ga0068863_100289751 3300005841 Bacteria 1587
18 Ga0068860_100039076 3300005843 Bacteria 4540
19 Ga0081539_10000025 3300005985 Bacteria 340255
20 Ga0081539_10000134 3300005985 Bacteria 173625
21 Ga0070716_100124581 3300006173 Bacteria 1619
22 Ga0075428_100054132 3300006844 Bacteria 4397
23 Ga0075430_100005751 3300006846 Bacteria 10462
24 Ga0075431_100049428 3300006847 Bacteria 4336
25 Ga0075431_100122561 3300006847 Bacteria 2682
26 Ga0075431_100148620 3300006847 Bacteria 2413
27 Ga0075431_100398938 3300006847 Bacteria 1377
28 Ga0075434_100039523 3300006871 Bacteria 4675
29 Ga0075434_100079412 3300006871 Bacteria 3277
30 Ga0075436_100213351 3300006914 Bacteria 1369
31 Ga0075435_100042316 3300007076 Bacteria 3644
32 Ga0111539_10078425 3300009094 Bacteria 3886
33 Ga0111539_10741852 3300009094 Bacteria 1143
34 Ga0105248_10372301 3300009177 Bacteria 1608
35 Ga0105237_10009596 3300009545 Bacteria 10364
36 Ga0105249_10096065 3300009553 Bacteria 2779
37 Ga0157378_10375115 3300013297 Bacteria 1396
38 Ga0163162_10060305 3300013306 Bacteria 3829
39 Ga0157380_10131777 3300014326 Bacteria 2134
40 Ga0207699_10000037 3300025906 Bacteria 126665
41 Ga0207650_10170051 3300025925 Bacteria 1732
42 Ga0207650_10542032 3300025925 Bacteria 975
43 Ga0207706_10130131 3300025933 Bacteria 2214
44 Ga0207665_10062244 3300025939 Bacteria 2532
45 Ga0207651_10006088 3300025960 Bacteria 6270
46 Ga0207658_10206954 3300025986 Bacteria 1642
47 Ga0207703_10325824 3300026035 Bacteria 1408
48 Ga0207675_100077434 3300026118 Bacteria 3115
49 Ga0207428_10044760 3300027907 Bacteria 3568
50 Ga0268264_10068820 3300028381 Bacteria 2993
51 Ga0307408_100008834 3300031548 Bacteria 6654
52 Ga0307410_10012416 3300031852 Bacteria 4925
53 Ga0307412_10007930 3300031911 Bacteria 6051
54 Ga0307409_100010367 3300031995 Bacteria 5790
55 Ga0307409_100040742 3300031995 Bacteria 3462
56 Ga0307416_100007724 3300032002 Bacteria 6870
57 Ga0307416_100008847 3300032002 Bacteria 6534
58 Ga0307416_100138147 3300032002 Bacteria 2209
59 Ga0307414_10009505 3300032004 Bacteria 5590
60 Ga0307411_10279552 3300032005 Bacteria 1328
61 Ga0307415_100002981 3300032126 Bacteria 8512
62 Ga0307415_100213667 3300032126 Bacteria 1541
63 Ga0373935_0053237 3300035692 Bacteria 2575
64 Ga0373925_0092852 3300037068 Bacteria 2309
65 Ga0395899_0179083 3300037312 Bacteria 1489
66 Ga0453683_0230121 3300044673 Bacteria 1180
67 Ga0451576_0442981 3300045051 Bacteria 1363
68 Ga0495580_0178625 3300046472 Bacteria 1466
69 Ga0495630_0160421 3300046517 Bacteria 1712
70 Ga0495666_0097276 3300046526 Bacteria 1388
71 Ga0495640_0122167 3300046533 Bacteria 1692
72 Ga0495586_0022260 3300046535 Bacteria 3381
73 Ga0495586_0093163 3300046535 Bacteria 1666
74 Ga0495622_0013114 3300046557 Bacteria 3845
75 Ga0495647_0009100 3300046681 Bacteria 3354
76 Ga0495658_0036667 3300046683 Bacteria 2707
77 Ga0495669_0024872 3300046684 Bacteria 2609
78 Ga0495613_0176105 3300046689 Bacteria 1516
79 Ga0495670_0184032 3300046691 Unclassified 1104
80 Ga0495680_0062042 3300047322 Bacteria 2874
81 Ga0495684_0105846 3300047471 Bacteria 2125
82 Ga0495602_0033506 3300048088 Bacteria 4818
83 Ga0496102_0078723 3300048905 Bacteria 3035
84 Ga0496109_0001242 3300048912 Bacteria 21132
85 Ga0496110_0003270 3300048913 Bacteria 12356
86 Ga0496113_0012191 3300048916 Bacteria 5769
87 Ga0501038_0343196 3300049574 Bacteria 1164
88 Ga0501046_0490042 3300049580 Bacteria 881
89 Ga0501048_0552375 3300049582 Bacteria 826
90 Ga0501067_0338467 3300049583 Bacteria 838
91 Ga0501071_0105845 3300049587 Bacteria 2077
92 Ga0501072_0021339 3300049588 Bacteria 5024
93 Ga0501072_0122334 3300049588 Bacteria 2073
94 Ga0501075_0296582 3300049591 Bacteria 1231
95 Ga0501076_0205785 3300049592 Bacteria 1607
96 Ga0501077_0012829 3300049593 Bacteria 5253
97 Ga0501077_0040625 3300049593 Bacteria 2963
98 Ga0501229_002527 3300049706 Bacteria 2156
99 Ga0501079_0015484 3300049741 Bacteria 5820
100 Ga0501079_0138830 3300049741 Bacteria 1893
101 Ga0501079_0228425 3300049741 Bacteria 1454
102 Ga0501045_0173907 3300049824 Bacteria 1604
103 nmdc:mga05p37_145001_c1 3300050507 Bacteria 2908
104 nmdc:mga09592_174007_c1 3300050508 Bacteria 1862
105 nmdc:mga0qj67_249341_c1 3300050509 Bacteria 1441
106 nmdc:mga0qj67_8394_c1 3300050509 Bacteria 7659
107 nmdc:mga08y16_34758_c1 3300050511 Bacteria 5295
108 nmdc:mga0n895_19136_c1 3300050512 Bacteria 6357
109 nmdc:mga0n895_21082_c1 3300050512 Bacteria 6090
110 nmdc:mga0rr50_127631_c1 3300050513 Bacteria 2032
111 nmdc:mga0rr50_48797_c1 3300050513 Bacteria 3131
112 nmdc:mga08x19_78561_c1 3300050514 Bacteria 2163
113 Ga0495619_0094120 3300053085 Bacteria 2032
114 Ga0501084_0046538 3300054114 Bacteria 3634
115 Ga0501084_0254391 3300054114 Bacteria 1483
116 Ga0590075_008540 3300059424 Bacteria 2447
117 Ga0530510_0264735 3300061734 Bacteria 1282
118 Ga0530510_0290553 3300061734 Bacteria 1222
119 Ga0265314_10000691
120 JGI25406J46586_10000388
121 JGI25406J46586_10000666
122 JGI25406J46586_10006698
123 Ga0070658_10221809
124 Ga0070667_100228995
125 Ga0070709_10000014
126 Ga0070694_100000113
127 Ga0070708_100091987
128 Ga0070662_100108697
129 Ga0070699_100000558
130 Ga0070699_100049514
131 Ga0070699_100237187
132 Ga0070697_100364102
133 Ga0070704_100058385
134 Ga0068861_100131505
135 Ga0068863_100289751
136 Ga0068860_100039076
137 Ga0081539_10000025
138 Ga0081539_10000134
139 Ga0070716_100124581
140 Ga0075428_100054132
141 Ga0075430_100005751
142 Ga0075431_100049428
143 Ga0075431_100122561
144 Ga0075431_100148620
145 Ga0075431_100398938
146 Ga0075434_100039523
147 Ga0075434_100079412
148 Ga0075436_100213351
149 Ga0075435_100042316
150 Ga0111539_10078425
151 Ga0111539_10741852
152 Ga0105248_10372301
153 Ga0105237_10009596
154 Ga0105249_10096065
155 Ga0157378_10375115
156 Ga0163162_10060305
157 Ga0157380_10131777
158 Ga0207699_10000037
159 Ga0207650_10170051
160 Ga0207650_10542032
161 Ga0207706_10130131
162 Ga0207665_10062244
163 Ga0207651_10006088
164 Ga0207658_10206954
165 Ga0207703_10325824
166 Ga0207675_100077434
167 Ga0207428_10044760
168 Ga0268264_10068820
169 Ga0307408_100008834
170 Ga0307410_10012416
171 Ga0307412_10007930
172 Ga0307409_100010367
173 Ga0307409_100040742
174 Ga0307416_100007724
175 Ga0307416_100008847
176 Ga0307416_100138147
177 Ga0307414_10009505
178 Ga0307411_10279552
179 Ga0307415_100002981
180 Ga0307415_100213667
181 Ga0373935_0053237
182 Ga0373925_0092852
183 Ga0395899_0179083
184 Ga0453683_0230121
185 Ga0451576_0442981
186 Ga0495580_0178625
187 Ga0495630_0160421
188 Ga0495666_0097276
189 Ga0495640_0122167
190 Ga0495586_0022260
191 Ga0495586_0093163
192 Ga0495622_0013114
193 Ga0495647_0009100
194 Ga0495658_0036667
195 Ga0495669_0024872
196 Ga0495613_0176105
197 Ga0495670_0184032
198 Ga0495680_0062042
199 Ga0495684_0105846
200 Ga0495602_0033506
201 Ga0496102_0078723
202 Ga0496109_0001242
203 Ga0496110_0003270
204 Ga0496113_0012191
205 Ga0501038_0343196
206 Ga0501046_0490042
207 Ga0501048_0552375
208 Ga0501067_0338467
209 Ga0501071_0105845
210 Ga0501072_0021339
211 Ga0501072_0122334
212 Ga0501075_0296582
213 Ga0501076_0205785
214 Ga0501077_0012829
215 Ga0501077_0040625
216 Ga0501229_002527
217 Ga0501079_0015484
218 Ga0501079_0138830
219 Ga0501079_0228425
220 Ga0501045_0173907
221 nmdc:mga05p37_145001_c1
222 nmdc:mga09592_174007_c1
223 nmdc:mga0qj67_249341_c1
224 nmdc:mga0qj67_8394_c1
225 nmdc:mga08y16_34758_c1
226 nmdc:mga0n895_19136_c1
227 nmdc:mga0n895_21082_c1
228 nmdc:mga0rr50_127631_c1
229 nmdc:mga0rr50_48797_c1
230 nmdc:mga08x19_78561_c1
231 Ga0495619_0094120
232 Ga0501084_0046538
233 Ga0501084_0254391
234 Ga0590075_008540
235 Ga0530510_0264735
236 Ga0530510_0290553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

243

272

0.97

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

134

212

0.94

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

1

118

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k82-assembly4.cif.gz_D crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna 0.9002 2 267
1k82-assembly4.cif.gz_D crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna 0.8936 2 267
1tdz-assembly1.cif.gz_A crystal structure complex between the lactococcus lactis fpg (mutm) and a fapy-dg containing dna 0.8865 3 267
1kfv-assembly1.cif.gz_A crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. 0.8856 3 267
4v7h-assembly1.cif.gz_AM structure of the 80s rrna and proteins and p/e trna for eukaryotic ribosome based on cryo-em map of thermomyces lanuginosus ribosome at 8.9a resolution 0.8807 154 201
ID Description Score Start End Superfamily
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9063 133 267 1.10.8.50
af_P05523_2_128_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.8932 2 123 3.20.190.10
1kfvB01 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.892 3 128 3.20.190.10
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8851 133 267 1.10.8.50
af_L0T864_10_149_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8763 133 274 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A2V6X5E8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9947 1 213 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7C4U9B8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9898 1 267 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7Y1SVG2-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9871 1 210 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039
AF-A0A2V6X5E8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9855 1 213 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7C4U9B8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9825 1 267 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078

Map