F097943

General Info

Members Datasets Scaffolds Average Seq Length
118 75 234 378

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100026773|Ga0307408_1000267732
Length 420
Sequence MKLVIYTIHESFYCKRNMNFLKYIIIPMIMVSILFSCKGKEETPEAEDHHEEDASTVELTEAQIKTAGIELGKVEPRQISGTIKVNGVLDVPPQQLVSISVPLGGFLKSTTLLQGSRVQKGQLIAVIENPEYIQLQQDYLEALNQFDFSKADYERQQELAKENVNAQKTLQQAKSTYQSWLAKRNGLLAKLKLIHVNLEEVEKGNISSTGNVYSPISGYVTEVNVNIGKFVAPSDVLFEIVDTEHLHAELTVFEKDVLKLRIGQRVRFTLANESEERMATVYLIGREISADRSVRIHCHIDKEDKELLPGMYLKANVETGGAKVPALPNEAVIDYQGKKYIFIPVEGEAHEHSPEEKHAKEEEEGTHFSMVEIQTGNSELGFTEVILPDTLNQSIDVVVKGAYSILSKIKNSEEEGGHAH

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
26 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
33 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
34 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
35 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
36 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
37 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
38 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
39 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
40 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
41 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
42 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
43 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
44 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
45 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
46 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
47 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
48 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
49 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
50 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
51 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
52 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
53 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
54 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
55 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
56 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
57 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
58 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
59 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
60 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
61 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
62 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
63 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
64 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
65 2739367663 Pedobacter sp. YR510 Isolate Unclassified
66 2818991444 Filimonas endophytica 3197 Isolate Unclassified
67 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
68 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
69 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
70 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
71 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
72 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
73 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
74 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
75 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.68
Metatranscriptomes 0
Isolates 9.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.25
Nodule 0
Rhizoplane 0
Rhizosphere 60.17
Stem 0
Stem Tuber 0
Unclassified 11.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100026773 3300031548 Bacteria 3966
2 rootH1_10013458 3300003316 Bacteria 8685
3 rootH1_10013458 3300003323 Bacteria 9160
4 rootH1_10101373 3300003316 Bacteria 4415
5 rootH1_10174882 3300003316 Unclassified 1721
6 rootL2_10006795 3300003322 Bacteria 6876
7 rootL2_10006796 3300003322 Bacteria 4569
8 rootL2_10031915 3300003322 Bacteria 13140
9 rootL2_10111213 3300003322 Bacteria 3730
10 rootL2_10168192 3300003322 Bacteria 6626
11 rootL2_10317131 3300003322 Unclassified 4044
12 rootH1_10001553 3300003323 Bacteria 3521
13 rootH1_10013874 3300003316 Bacteria 3907
14 rootH1_10013874 3300003323 Bacteria 79495
15 rootH1_10196550 3300003323 Unclassified 3626
16 rootH1_10236859 3300003323 Bacteria 4129
17 rootH1_10237037 3300003323 Bacteria 3581
18 rootH1_10275727 3300003323 Bacteria 3141
19 Ga0055535_1001937 3300003761 Bacteria 8638
20 Ga0055535_1003528 3300003761 Unclassified 4365
21 Ga0055542_1004162 3300003762 Unclassified 3630
22 Ga0055531_10000033 3300003794 Bacteria 152935
23 Ga0065714_10003196 3300005288 Bacteria 23467
24 Ga0065704_10070574 3300005289 Bacteria 20061
25 Ga0065715_10091025 3300005293 Bacteria 6199
26 Ga0070660_100002932 3300005339 Bacteria 11740
27 Ga0068857_100165496 3300005577 Bacteria 2008
28 Ga0068856_100216576 3300005614 Bacteria 1930
29 Ga0068852_100162354 3300005616 Bacteria 2087
30 Ga0070716_100120900 3300006173 Unclassified 1639
31 Ga0111539_10088042 3300009094 Unclassified 3648
32 Ga0105239_10029231 3300010375 Bacteria 6060
33 Ga0157371_10003332 3300013102 Bacteria 14672
34 Ga0157370_10041929 3300013104 Bacteria 4412
35 Ga0157370_10074042 3300013104 Bacteria 3213
36 Ga0157370_10201457 3300013104 Bacteria 1846
37 Ga0157369_10067302 3300013105 Bacteria 3851
38 Ga0157372_10208568 3300013307 Bacteria 2264
39 Ga0157372_10258209 3300013307 Bacteria 2023
40 Ga0157380_10058608 3300014326 Bacteria 3070
41 Ga0157380_10259968 3300014326 Unclassified 1576
42 Ga0182008_10000012 3300014497 Bacteria 297475
43 Ga0209258_100036 3300025242 Bacteria 428859
44 Ga0209646_1009316 3300025246 Unclassified 1561
45 Ga0209148_1000139 3300025254 Bacteria 167011
46 Ga0209257_1000023 3300025304 Bacteria 753019
47 Ga0207671_10008504 3300025914 Bacteria 8695
48 Ga0207665_10162608 3300025939 Unclassified 1607
49 Ga0207702_10156515 3300026078 Unclassified 2078
50 Ga0207698_10158558 3300026142 Bacteria 1975
51 Ga0207428_10059498 3300027907 Unclassified 3029
52 Ga0307515_10000012 3300028794 Bacteria 582232
53 Ga0307515_10057129 3300028794 Bacteria 5654
54 Ga0265327_10022287 3300031251 Bacteria 3793
55 Ga0307513_10229516 3300031456 Bacteria 1670
56 Ga0439431_0000457 3300041997 Bacteria 8622
57 Ga0439445_0005152 3300042004 Bacteria 2972
58 Ga0451577_0000617 3300042876 Bacteria 57184
59 Ga0451577_0010167 3300042876 Bacteria 9014
60 Ga0451577_0016711 3300042876 Bacteria 6786
61 Ga0451577_0046237 3300042876 Bacteria 3895
62 Ga0451577_0046579 3300042876 Bacteria 3879
63 Ga0451577_0050952 3300042876 Bacteria 3696
64 Ga0451577_0059568 3300042876 Bacteria 3404
65 Ga0451577_0087047 3300042876 Bacteria 2787
66 Ga0451577_0189334 3300042876 Bacteria 1856
67 Ga0453683_0000419 3300044673 Bacteria 49343
68 Ga0453683_0061968 3300044673 Bacteria 2338
69 Ga0453684_0001748 3300044712 Bacteria 58096
70 Ga0453684_0003018 3300044712 Bacteria 39143
71 Ga0453684_0010429 3300044712 Bacteria 15896
72 Ga0453684_0022845 3300044712 Bacteria 9258
73 Ga0453684_0049665 3300044712 Bacteria 5528
74 Ga0453684_0075042 3300044712 Bacteria 4253
75 Ga0453684_0230307 3300044712 Bacteria 2139
76 Ga0453684_0369274 3300044712 Bacteria 1613
77 Ga0451576_0003574 3300045051 Bacteria 21154
78 Ga0451576_0013774 3300045051 Bacteria 9034
79 Ga0451576_0020768 3300045051 Bacteria 7148
80 Ga0451576_0022715 3300045051 Bacteria 6796
81 Ga0451576_0198979 3300045051 Bacteria 2093
82 Ga0495668_0001483 3300046616 Bacteria 22483
83 Ga0495625_0013332 3300046660 Bacteria 6609
84 Ga0496121_0153756 3300048924 Bacteria 1690
85 Ga0496122_0018331 3300048925 Bacteria 6478
86 Ga0496123_0017219 3300048926 Bacteria 5828
87 Ga0496124_0135970 3300048927 Bacteria 1946
88 Ga0496125_0000547 3300048928 Bacteria 64865
89 Ga0501300_002609 3300049523 Bacteria 2704
90 Ga0501034_0002188 3300049571 Bacteria 24185
91 Ga0501034_0012440 3300049571 Bacteria 8789
92 Ga0501257_000476 3300049686 Bacteria 7983
93 Ga0501241_000502 3300049758 Bacteria 8438
94 Ga0501264_000004 3300049761 Bacteria 35907
95 Ga0501284_00014 3300050005 Bacteria 114419
96 nmdc:mga06r32_59089_c1 3300050510 Unclassified 3686
97 nmdc:mga08y16_27602_c1 3300050511 Bacteria 5981
98 nmdc:mga08y16_43636_c1 3300050511 Bacteria 4700
99 Ga0500644_0000332 3300053088 Bacteria 24138
100 Ga0500646_0019692 3300053090 Bacteria 1787
101 Ga0500658_0015669 3300053134 Bacteria 2817
102 Ga0500559_0011039 3300053136 Bacteria 3868
103 Ga0500573_0028767 3300053140 Bacteria 3202
104 Ga0500577_0019661 3300053142 Unclassified 2194
105 Ga0500604_0020428 3300053151 Bacteria 1864
106 Ga0500622_0000005 3300053156 Bacteria 502443
107 Ga0500622_0001761 3300053156 Bacteria 16623
108 2739648182 2739367663 Bacteria 5040914
109 2819585882 2818991444 Bacteria 6968812
110 2819681197 2818991460 Bacteria 7595395
111 2883072359 2883068021 Bacteria 6192739
112 2896089256 2896085136 Bacteria 6129793
113 2902051501 2902048731 Bacteria 4976191
114 2910251091 2910245624 Bacteria 6935613
115 2911141654 2911138879 Bacteria 5811561
116 2919189301 2919186247 Bacteria 6244071
117 2929244155 2929239360 Bacteria 7745570
118 2939666544 2939664404 Bacteria 6364494
119 Ga0307408_100026773
120 rootH1_10013458
121 rootH1_10101373
122 rootH1_10174882
123 rootL2_10006795
124 rootL2_10006796
125 rootL2_10031915
126 rootL2_10111213
127 rootL2_10168192
128 rootL2_10317131
129 rootH1_10001553
130 rootH1_10013874
131 rootH1_10196550
132 rootH1_10236859
133 rootH1_10237037
134 rootH1_10275727
135 Ga0055535_1001937
136 Ga0055535_1003528
137 Ga0055542_1004162
138 Ga0055531_10000033
139 Ga0065714_10003196
140 Ga0065704_10070574
141 Ga0065715_10091025
142 Ga0070660_100002932
143 Ga0068857_100165496
144 Ga0068856_100216576
145 Ga0068852_100162354
146 Ga0070716_100120900
147 Ga0111539_10088042
148 Ga0105239_10029231
149 Ga0157371_10003332
150 Ga0157370_10041929
151 Ga0157370_10074042
152 Ga0157370_10201457
153 Ga0157369_10067302
154 Ga0157372_10208568
155 Ga0157372_10258209
156 Ga0157380_10058608
157 Ga0157380_10259968
158 Ga0182008_10000012
159 Ga0209258_100036
160 Ga0209646_1009316
161 Ga0209148_1000139
162 Ga0209257_1000023
163 Ga0207671_10008504
164 Ga0207665_10162608
165 Ga0207702_10156515
166 Ga0207698_10158558
167 Ga0207428_10059498
168 Ga0307515_10000012
169 Ga0307515_10057129
170 Ga0265327_10022287
171 Ga0307513_10229516
172 Ga0439431_0000457
173 Ga0439445_0005152
174 Ga0451577_0000617
175 Ga0451577_0010167
176 Ga0451577_0016711
177 Ga0451577_0046237
178 Ga0451577_0046579
179 Ga0451577_0050952
180 Ga0451577_0059568
181 Ga0451577_0087047
182 Ga0451577_0189334
183 Ga0453683_0000419
184 Ga0453683_0061968
185 Ga0453684_0001748
186 Ga0453684_0003018
187 Ga0453684_0010429
188 Ga0453684_0022845
189 Ga0453684_0049665
190 Ga0453684_0075042
191 Ga0453684_0230307
192 Ga0453684_0369274
193 Ga0451576_0003574
194 Ga0451576_0013774
195 Ga0451576_0020768
196 Ga0451576_0022715
197 Ga0451576_0198979
198 Ga0495668_0001483
199 Ga0495625_0013332
200 Ga0496121_0153756
201 Ga0496122_0018331
202 Ga0496123_0017219
203 Ga0496124_0135970
204 Ga0496125_0000547
205 Ga0501300_002609
206 Ga0501034_0002188
207 Ga0501034_0012440
208 Ga0501257_000476
209 Ga0501241_000502
210 Ga0501264_000004
211 Ga0501284_00014
212 nmdc:mga06r32_59089_c1
213 nmdc:mga08y16_27602_c1
214 nmdc:mga08y16_43636_c1
215 Ga0500644_0000332
216 Ga0500646_0019692
217 Ga0500658_0015669
218 Ga0500559_0011039
219 Ga0500573_0028767
220 Ga0500577_0019661
221 Ga0500604_0020428
222 Ga0500622_0000005
223 Ga0500622_0001761
224 2739648182
225 2819585882
226 2819681197
227 2883072359
228 2896089256
229 2902051501
230 2910251091
231 2911141654
232 2919189301
233 2929244155
234 2939666544

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13437

HlyD_3

HlyD family secretion protein

211

310

0.87

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

78

313

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ks8-assembly1.cif.gz_F crystal structure of two-subunit pyruvate carboxylase from methylobacillus flagellatus 0.9506 85 229
7wtb-assembly1.cif.gz_A cryo-em structure of human pyruvate carboxylase with acetyl-coa 0.9371 85 227
7wta-assembly1.cif.gz_D cryo-em structure of human pyruvate carboxylase in apo state 0.9039 85 227
2d5d-assembly1.cif.gz_A structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii 0.8932 85 227
5gu9-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant 0.8901 85 227
ID Description Score Start End Superfamily
af_P9WHG3_5_101_1.10.287.40 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.9605 125 174 1.10.287.40
af_Q54KE6_633_699_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9604 86 228 2.40.50.100
af_Q91ZA3_659_724_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.96 88 227 2.40.50.100
1vf7K03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9563 121 178 1.10.287.470
1vf7L03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9555 121 178 1.10.287.470
ID Description Score Start End GO Terms
AF-A0A2I9EHL8-F1-model_v4 Cobalt-zinc-cadmium resistance protein CzcB 0.8825 24 384 GO:0015679
GO:0016020
GO:0022857
GO:0030313
GO:0060003
AF-A0A3B9T6E4-F1-model_v4 Efflux transporter periplasmic adaptor subunit 0.8578 24 310 GO:0015679
GO:0016020
GO:0022857
GO:0030313
GO:0060003
AF-S7VU23-F1-model_v4 Putative Co/Zn/Cd efflux system membrane fusion protein 0.8567 24 291 GO:0015679
GO:0016020
GO:0022857
GO:0030313
GO:0060003
AF-A0A1Q3PK76-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.8348 24 385 GO:0015679
GO:0016020
GO:0022857
GO:0030313
GO:0060003
AF-A0A3C0GLY6-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8306 24 263 GO:0015679
GO:0030313
GO:0060003

Map