F097783

General Info

Members Datasets Scaffolds Average Seq Length
118 68 236 392

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10008523|Ga0265323_100085233
Length 422
Sequence MQKRIVDPCSSVTSVVPIAFSRTDATGAARLAIVLSHPTQYYSPWFRWLRAHTTIEFRVFYLWDFGVTNRRDPEFGAKLVWDVDLLSGYASEFVPNCAARAGTGHFWGLRNPALPGRLAAWRPDAVLLFGYHYYTQLRAIAWCRLHQVPLLFRGDSHLLGQPRPSLLKRLALRTLYRQFAAVTYVGAANRAYFETFGVPTDRLHFAPHAVDHEHFDPTNPAHQDAARQLRTELSLAPGQRVVLFAGKLIPRKQPLALLDAFLSAPRTGVTLLFVGDGEDKPALQAQAAQHPGAEVRFLPFANQSEMPARYLLADLFVLPSRGNSETWGLAVNEAMHMGVPCLVSDLVGCQRDLVTDGETGWVFRAGDPAHLRAKLDEALAALEDNPAGLKARVAARIADYTYQQTTDGLVCALKATHRTKQP

Samples

Sample ID Description Type Environment
1 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
9 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
10 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
11 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
12 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
13 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
14 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
22 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
23 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
24 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
25 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
26 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
27 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
28 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
29 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
30 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
31 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
32 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
33 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
34 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
35 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
36 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
37 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
38 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
39 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
40 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
46 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
47 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
48 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
49 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
50 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
51 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
52 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
67 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
68 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 92.37
Stem 0
Stem Tuber 0
Unclassified 6.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265323_10008523 3300028653 Bacteria 4225
2 rootH2_10028377 3300003320 Bacteria 43972
3 rootH2_10032765 3300003320 Bacteria 31514
4 rootH1_10072744 3300003323 Bacteria 7822
5 rootH1_10291606 3300003323 Bacteria 5170
6 rootH1_10341579 3300003323 Bacteria 2064
7 Ga0068868_100076480 3300005338 Bacteria 2676
8 Ga0070679_100016675 3300005530 Bacteria 7095
9 Ga0068853_100143024 3300005539 Bacteria 2148
10 Ga0068856_100032325 3300005614 Bacteria 5122
11 Ga0068856_100184511 3300005614 Bacteria 2100
12 Ga0070717_10000060 3300006028 Bacteria 92521
13 Ga0097621_100048941 3300006237 Bacteria 3432
14 Ga0068871_100001257 3300006358 Bacteria 16953
15 Ga0068865_100028713 3300006881 Bacteria 3684
16 Ga0213873_10031661 3300021358 Bacteria 1317
17 Ga0213876_10066253 3300021384 Bacteria 1906
18 Ga0207705_10026621 3300025909 Bacteria 4123
19 Ga0207652_10005021 3300025921 Bacteria 10720
20 Ga0207704_10003507 3300025938 Bacteria 7136
21 Ga0207689_10003746 3300025942 Bacteria 13863
22 Ga0207677_10057806 3300026023 Bacteria 2666
23 Ga0207639_10129106 3300026041 Bacteria 2090
24 Ga0207702_10000829 3300026078 Bacteria 32602
25 Ga0265337_1002813 3300028556 Bacteria 7783
26 Ga0265319_1000008 3300028563 Bacteria 215029
27 Ga0265319_1000391 3300028563 Bacteria 31727
28 Ga0265319_1001654 3300028563 Bacteria 12905
29 Ga0265319_1004968 3300028563 Bacteria 6480
30 Ga0265319_1011264 3300028563 Bacteria 3673
31 Ga0265318_10000023 3300028577 Bacteria 160826
32 Ga0265318_10000556 3300028577 Bacteria 26313
33 Ga0265318_10002402 3300028577 Bacteria 10014
34 Ga0265318_10005687 3300028577 Bacteria 5833
35 Ga0265318_10057162 3300028577 Bacteria 1458
36 Ga0265323_10000126 3300028653 Bacteria 43711
37 Ga0265323_10001632 3300028653 Bacteria 10787
38 Ga0265323_10006505 3300028653 Bacteria 4913
39 Ga0265323_10016157 3300028653 Bacteria 2919
40 Ga0265323_10033423 3300028653 Bacteria 1904
41 Ga0265323_10041616 3300028653 Bacteria 1666
42 Ga0265322_10002300 3300028654 Bacteria 5923
43 Ga0265322_10003674 3300028654 Bacteria 4622
44 Ga0265336_10000557 3300028666 Bacteria 21234
45 Ga0265336_10007881 3300028666 Bacteria 3767
46 Ga0265338_10020760 3300028800 Bacteria 6889
47 Ga0265324_10005403 3300029957 Bacteria 5524
48 Ga0265330_10015932 3300031235 Bacteria 3473
49 Ga0265330_10029932 3300031235 Unclassified 2447
50 Ga0265320_10004158 3300031240 Bacteria 9508
51 Ga0265320_10004923 3300031240 Bacteria 8665
52 Ga0265320_10005732 3300031240 Bacteria 7920
53 Ga0265320_10007063 3300031240 Bacteria 7003
54 Ga0265320_10018570 3300031240 Bacteria 3824
55 Ga0265320_10036627 3300031240 Bacteria 2477
56 Ga0265320_10038779 3300031240 Bacteria 2387
57 Ga0265320_10039920 3300031240 Unclassified 2343
58 Ga0265325_10016720 3300031241 Unclassified 4095
59 Ga0265329_10035823 3300031242 Unclassified 1601
60 Ga0265340_10061216 3300031247 Bacteria 1801
61 Ga0265331_10004719 3300031250 Bacteria 8432
62 Ga0265331_10006220 3300031250 Bacteria 7085
63 Ga0265331_10011841 3300031250 Unclassified 4759
64 Ga0265327_10000023 3300031251 Bacteria 382703
65 Ga0265327_10002897 3300031251 Bacteria 17226
66 Ga0265327_10007236 3300031251 Bacteria 8616
67 Ga0265327_10021718 3300031251 Bacteria 3864
68 Ga0265327_10029224 3300031251 Bacteria 3138
69 Ga0265316_10001922 3300031344 Bacteria 21826
70 Ga0265316_10003489 3300031344 Bacteria 15870
71 Ga0265316_10010158 3300031344 Bacteria 8597
72 Ga0265316_10012444 3300031344 Bacteria 7629
73 Ga0265316_10016609 3300031344 Bacteria 6381
74 Ga0307408_100000007 3300031548 Bacteria 463086
75 Ga0265313_10005247 3300031595 Bacteria 9594
76 Ga0265313_10014061 3300031595 Bacteria 4761
77 Ga0307508_10000031 3300031616 Bacteria 163301
78 Ga0265314_10001764 3300031711 Bacteria 23355
79 Ga0265314_10008048 3300031711 Bacteria 9081
80 Ga0265314_10008741 3300031711 Bacteria 8657
81 Ga0265342_10010155 3300031712 Bacteria 6559
82 Ga0265342_10031278 3300031712 Unclassified 3292
83 Ga0265342_10042890 3300031712 Bacteria 2731
84 Ga0307410_10000001 3300031852 Bacteria 162839
85 Ga0307407_10000671 3300031903 Bacteria 11050
86 Ga0307409_100000033 3300031995 Bacteria 48825
87 Ga0307416_100000111 3300032002 Bacteria 50097
88 Ga0373951_0009518 3300035091 Bacteria 2187
89 Ga0373925_0015602 3300037068 Bacteria 5496
90 Ga0395905_0270349 3300037471 Bacteria 1586
91 Ga0436365_0635332 3300039437 Bacteria 13725
92 Ga0436360_0380798 3300039438 Unclassified 1783
93 Ga0436362_0768563 3300039453 Bacteria 5410
94 Ga0453684_0019437 3300044712 Bacteria 10344
95 Ga0453684_0092479 3300044712 Bacteria 3729
96 Ga0451576_0001196 3300045051 Bacteria 46432
97 Ga0466967_0027571 3300045976 Bacteria 4727
98 Ga0501031_0006292 3300049568 Bacteria 7738
99 Ga0501032_0001767 3300049569 Bacteria 17060
100 Ga0501033_0005911 3300049570 Bacteria 9611
101 Ga0501033_0106990 3300049570 Bacteria 2037
102 Ga0501036_0137789 3300049572 Bacteria 2059
103 Ga0501037_0076189 3300049573 Bacteria 2435
104 Ga0501038_0000256 3300049574 Bacteria 44941
105 Ga0501039_0075541 3300049575 Bacteria 2619
106 Ga0501042_0039521 3300049578 Bacteria 3353
107 Ga0501046_0000645 3300049580 Bacteria 34119
108 Ga0501046_0022052 3300049580 Bacteria 5250
109 Ga0501047_0019330 3300049581 Bacteria 6536
110 Ga0501047_0031658 3300049581 Bacteria 5103
111 Ga0501047_0158666 3300049581 Bacteria 2134
112 Ga0501048_0126190 3300049582 Bacteria 1809
113 Ga0501044_0002090 3300049823 Bacteria 22997
114 Ga0501044_0111531 3300049823 Bacteria 2743
115 Ga0501044_0329348 3300049823 Unclassified 1450
116 Ga0501045_0084039 3300049824 Bacteria 2348
117 Ga0501082_0061561 3300060353 Bacteria 3231
118 2788436483 2786546940 Bacteria 6396474
119 Ga0265323_10008523
120 rootH2_10028377
121 rootH2_10032765
122 rootH1_10072744
123 rootH1_10291606
124 rootH1_10341579
125 Ga0068868_100076480
126 Ga0070679_100016675
127 Ga0068853_100143024
128 Ga0068856_100032325
129 Ga0068856_100184511
130 Ga0070717_10000060
131 Ga0097621_100048941
132 Ga0068871_100001257
133 Ga0068865_100028713
134 Ga0213873_10031661
135 Ga0213876_10066253
136 Ga0207705_10026621
137 Ga0207652_10005021
138 Ga0207704_10003507
139 Ga0207689_10003746
140 Ga0207677_10057806
141 Ga0207639_10129106
142 Ga0207702_10000829
143 Ga0265337_1002813
144 Ga0265319_1000008
145 Ga0265319_1000391
146 Ga0265319_1001654
147 Ga0265319_1004968
148 Ga0265319_1011264
149 Ga0265318_10000023
150 Ga0265318_10000556
151 Ga0265318_10002402
152 Ga0265318_10005687
153 Ga0265318_10057162
154 Ga0265323_10000126
155 Ga0265323_10001632
156 Ga0265323_10006505
157 Ga0265323_10016157
158 Ga0265323_10033423
159 Ga0265323_10041616
160 Ga0265322_10002300
161 Ga0265322_10003674
162 Ga0265336_10000557
163 Ga0265336_10007881
164 Ga0265338_10020760
165 Ga0265324_10005403
166 Ga0265330_10015932
167 Ga0265330_10029932
168 Ga0265320_10004158
169 Ga0265320_10004923
170 Ga0265320_10005732
171 Ga0265320_10007063
172 Ga0265320_10018570
173 Ga0265320_10036627
174 Ga0265320_10038779
175 Ga0265320_10039920
176 Ga0265325_10016720
177 Ga0265329_10035823
178 Ga0265340_10061216
179 Ga0265331_10004719
180 Ga0265331_10006220
181 Ga0265331_10011841
182 Ga0265327_10000023
183 Ga0265327_10002897
184 Ga0265327_10007236
185 Ga0265327_10021718
186 Ga0265327_10029224
187 Ga0265316_10001922
188 Ga0265316_10003489
189 Ga0265316_10010158
190 Ga0265316_10012444
191 Ga0265316_10016609
192 Ga0307408_100000007
193 Ga0265313_10005247
194 Ga0265313_10014061
195 Ga0307508_10000031
196 Ga0265314_10001764
197 Ga0265314_10008048
198 Ga0265314_10008741
199 Ga0265342_10010155
200 Ga0265342_10031278
201 Ga0265342_10042890
202 Ga0307410_10000001
203 Ga0307407_10000671
204 Ga0307409_100000033
205 Ga0307416_100000111
206 Ga0373951_0009518
207 Ga0373925_0015602
208 Ga0395905_0270349
209 Ga0436365_0635332
210 Ga0436360_0380798
211 Ga0436362_0768563
212 Ga0453684_0019437
213 Ga0453684_0092479
214 Ga0451576_0001196
215 Ga0466967_0027571
216 Ga0501031_0006292
217 Ga0501032_0001767
218 Ga0501033_0005911
219 Ga0501033_0106990
220 Ga0501036_0137789
221 Ga0501037_0076189
222 Ga0501038_0000256
223 Ga0501039_0075541
224 Ga0501042_0039521
225 Ga0501046_0000645
226 Ga0501046_0022052
227 Ga0501047_0019330
228 Ga0501047_0031658
229 Ga0501047_0158666
230 Ga0501048_0126190
231 Ga0501044_0002090
232 Ga0501044_0111531
233 Ga0501044_0329348
234 Ga0501045_0084039
235 Ga0501082_0061561
236 2788436483

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

226

394

0.94

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

239

381

0.88

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

200

406

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lfl-assembly1.cif.gz_A crystal structure of a class a gpcr 0.8478 179 367
2bfw-assembly1.cif.gz_A structure of the c domain of glycogen synthase from pyrococcus abyssi 0.8464 179 368
5ws3-assembly1.cif.gz_A crystal structures of human orexin 2 receptor bound to the selective antagonist empa determined by serial femtosecond crystallography at sacla 0.8369 187 384
6kuw-assembly1.cif.gz_B crystal structure of human alpha2c adrenergic g protein-coupled receptor. 0.8334 178 384
5wqc-assembly1.cif.gz_A crystal structure of human orexin 2 receptor bound to the selective antagonist empa determined by the synchrotron light source at spring-8. 0.8322 187 384
ID Description Score Start End Superfamily
af_Q4D163_355_523_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8858 196 363 3.40.50.2000
af_Q4D163_355_523_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8664 196 363 3.40.50.2000
af_Q5NBB8_258_456_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8596 186 368 3.40.50.2000
af_Q7KWM5_214_420_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8596 203 382 3.40.50.2000
af_Q58469_205_369_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8579 198 360 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A1G4AJM7-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9845 2 384 GO:0016757
AF-A0A2A2QCY1-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9787 2 381 GO:0016757
AF-A0A1G4AJM7-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.972 2 384 GO:0016757
AF-A0A844MDA8-F1-model_v4 Glycosyltransferase 0.9697 1 382 GO:0016758
AF-A0A6P0NJ40-F1-model_v4 Glycosyltransferase family 4 protein 0.9612 34 386 GO:0016758

Map