F097207

General Info

Members Datasets Scaffolds Average Seq Length
118 83 118 186

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10531520|Ga0105248_105315202
Length 219
Sequence MRVRSPCKYWICLLTLSILSLFLLKPDLWRERRANTGEEMSVMISMLRGVNVGGNNKIKMTELKALYESLGFTDVQTYIQSGNVVFKSSAKDSATLGKKIGTAIEKKCGFCPEVIVRTPEELREVIARNPFSKRKDIEPGKLLVMFLAADPGAAARKTLKSVEAPVEEIKPLGKEIYIYFPDGQGQSKLKFAQIDKAINKTAWTGRNWNTVLKLAEMCD

Samples

Sample ID Description Type Environment
1 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
28 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
41 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
59 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
70 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
71 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
72 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
73 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
74 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
75 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
76 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
77 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
78 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
83 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 1.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 2.54
Rhizosphere 91.53
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055541_1001452 3300003841 Bacteria 5146
2 Ga0065715_10461251 3300005293 Unclassified 816
3 Ga0070680_100068735 3300005336 Unclassified 2908
4 Ga0068868_100472253 3300005338 Unclassified 1094
5 Ga0070669_100462595 3300005353 Bacteria 1047
6 Ga0070709_11050969 3300005434 Unclassified 649
7 Ga0070714_100106931 3300005435 Bacteria 2472
8 Ga0070714_100323979 3300005435 Bacteria 1442
9 Ga0070711_100020619 3300005439 Bacteria 4252
10 Ga0070711_100620485 3300005439 Unclassified 904
11 Ga0070708_100001421 3300005445 Bacteria 18273
12 Ga0070708_100051568 3300005445 Bacteria 3646
13 Ga0070708_100117337 3300005445 Bacteria 2451
14 Ga0070706_100004180 3300005467 Bacteria 14020
15 Ga0070706_100187220 3300005467 Bacteria 1934
16 Ga0070706_100293356 3300005467 Bacteria 1517
17 Ga0070706_100307835 3300005467 Bacteria 1478
18 Ga0070707_100193773 3300005468 Unclassified 1981
19 Ga0070698_100002582 3300005471 Bacteria 19939
20 Ga0070698_100005766 3300005471 Bacteria 13541
21 Ga0070699_100000688 3300005518 Bacteria 31515
22 Ga0070699_100625525 3300005518 Bacteria 982
23 Ga0070697_100009304 3300005536 Bacteria 7680
24 Ga0070697_100229249 3300005536 Bacteria 1584
25 Ga0070697_100351090 3300005536 Bacteria 1274
26 Ga0068853_100576767 3300005539 Bacteria 1067
27 Ga0070686_100730402 3300005544 Unclassified 792
28 Ga0070696_100100081 3300005546 Unclassified 2076
29 Ga0070665_100137949 3300005548 Bacteria 2442
30 Ga0068858_100044144 3300005842 Bacteria 4133
31 Ga0070717_10138568 3300006028 Bacteria 2097
32 Ga0070717_10194761 3300006028 Bacteria 1772
33 Ga0070716_100023342 3300006173 Bacteria 3279
34 Ga0070716_100050971 3300006173 Unclassified 2351
35 Ga0070712_100023047 3300006175 Bacteria 4107
36 Ga0097621_100634788 3300006237 Bacteria 979
37 Ga0075431_100753708 3300006847 Unclassified 949
38 Ga0075434_100639590 3300006871 Bacteria 1082
39 Ga0075436_100008974 3300006914 Bacteria 6843
40 Ga0099794_10018359 3300007265 Bacteria 3135
41 Ga0099794_10021964 3300007265 Bacteria 2905
42 Ga0099794_10160409 3300007265 Bacteria 1144
43 Ga0099794_10303553 3300007265 Unclassified 827
44 Ga0099795_10010681 3300007788 Bacteria 2714
45 Ga0105240_10193621 3300009093 Bacteria 2389
46 Ga0105240_10229845 3300009093 Bacteria 2156
47 Ga0105245_10036802 3300009098 Bacteria 4349
48 Ga0105243_10226753 3300009148 Bacteria 1655
49 Ga0105248_10012185 3300009177 Bacteria 9485
50 Ga0105248_10531520 3300009177 Bacteria 1326
51 Ga0105237_10124933 3300009545 Unclassified 2567
52 Ga0105239_10156679 3300010375 Bacteria 2543
53 Ga0157378_10014474 3300013297 Archaea 6906
54 Ga0163162_10371066 3300013306 Unclassified 1564
55 Ga0157375_10188589 3300013308 Unclassified 2216
56 Ga0163163_10073025 3300014325 Bacteria 3421
57 Ga0163163_10152777 3300014325 Bacteria 2352
58 Ga0213875_10000005 3300021388 Bacteria 595146
59 Ga0224572_1000130 3300024225 Bacteria 6241
60 Ga0209566_100190 3300025225 Bacteria 64865
61 Ga0207685_10222902 3300025905 Bacteria 898
62 Ga0207684_10011737 3300025910 Bacteria 7642
63 Ga0207684_10158843 3300025910 Bacteria 1946
64 Ga0207654_10629485 3300025911 Unclassified 767
65 Ga0207695_10189187 3300025913 Bacteria 1976
66 Ga0207695_10396780 3300025913 Bacteria 1264
67 Ga0207671_10118350 3300025914 Bacteria 2023
68 Ga0207693_10064932 3300025915 Bacteria 2859
69 Ga0207693_10118555 3300025915 Bacteria 2078
70 Ga0207693_10135193 3300025915 Bacteria 1938
71 Ga0207663_10470254 3300025916 Bacteria 972
72 Ga0207646_10048605 3300025922 Bacteria 3802
73 Ga0207687_10246726 3300025927 Unclassified 1417
74 Ga0207700_10639067 3300025928 Bacteria 948
75 Ga0207665_10083955 3300025939 Bacteria 2197
76 Ga0207665_10105777 3300025939 Bacteria 1971
77 Ga0207665_10209301 3300025939 Unclassified 1424
78 Ga0207665_10226613 3300025939 Unclassified 1372
79 Ga0207703_10533983 3300026035 Unclassified 1105
80 Ga0209588_1039563 3300027671 Bacteria 1520
81 Ga0209588_1067848 3300027671 Bacteria 1152
82 Ga0268266_10040425 3300028379 Bacteria 3975
83 Ga0265770_1013207 3300030878 Unclassified 1232
84 Ga0265760_10004593 3300031090 Bacteria 3957
85 Ga0373934_0024341 3300035086 Bacteria 2341
86 Ga0373957_0136740 3300035120 Bacteria 1000
87 Ga0373935_0077549 3300035692 Bacteria 2154
88 Ga0373927_0188647 3300035695 Unclassified 1352
89 Ga0373947_0056796 3300035725 Bacteria 2367
90 Ga0373937_0019203 3300036401 Bacteria 6119
91 Ga0373937_0127533 3300036401 Bacteria 2374
92 Ga0373925_0229516 3300037068 Unclassified 1484
93 Ga0436364_0157811 3300037853 Bacteria 430293
94 Ga0436364_0331690 3300037853 Bacteria 1712
95 Ga0436364_1032849 3300037853 Bacteria 3332
96 Ga0439434_0011115 3300042435 Unclassified 2659
97 Ga0451577_0905155 3300042876 Bacteria 794
98 Ga0453684_0000344 3300044712 Bacteria 192860
99 Ga0453684_0013661 3300044712 Bacteria 13155
100 Ga0453684_0074477 3300044712 Bacteria 4274
101 Ga0495651_0529836 3300046462 Bacteria 751
102 Ga0495580_0197735 3300046472 Bacteria 1386
103 Ga0495667_0279922 3300046559 Bacteria 1059
104 Ga0495667_0471002 3300046559 Bacteria 788
105 Ga0495623_0102148 3300046679 Bacteria 1746
106 Ga0495669_0114133 3300046684 Bacteria 1263
107 Ga0495604_0080524 3300047317 Bacteria 2440
108 Ga0495674_0139163 3300047319 Bacteria 2041
109 Ga0495677_0123482 3300047445 Bacteria 988
110 Ga0495684_0018587 3300047471 Bacteria 5355
111 Ga0496109_0476806 3300048912 Unclassified 1178
112 Ga0496112_0332837 3300048915 Unclassified 1462
113 Ga0496112_0794984 3300048915 Bacteria 871
114 Ga0496125_0181087 3300048928 Bacteria 1404
115 Ga0501034_0062880 3300049571 Bacteria 3727
116 nmdc:mga0n895_1464159_c1 3300050512 Unclassified 650
117 nmdc:mga0n895_641976_c1 3300050512 Bacteria 1061
118 nmdc:mga08x19_15988_c1 3300050514 Bacteria 4571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_1464159_c1 nmdc:mga0n895_1464159_c1_24_518 160
2 3300006028 Ga0070717_10138568 Ga0070717_101385682 163
3 3300005434 Ga0070709_11050969 Ga0070709_110509691 168
4 3300005439 Ga0070711_100620485 Ga0070711_1006204851 172
5 3300005353 Ga0070669_100462595 Ga0070669_1004625952 174
6 3300009148 Ga0105243_10226753 Ga0105243_102267531 174
7 3300048928 Ga0496125_0181087 Ga0496125_0181087_300_830 174
8 3300005445 Ga0070708_100001421 Ga0070708_10000142111 175
9 3300005467 Ga0070706_100004180 Ga0070706_10000418011 175
10 3300005467 Ga0070706_100307835 Ga0070706_1003078353 175
11 3300005468 Ga0070707_100193773 Ga0070707_1001937733 175
12 3300005471 Ga0070698_100002582 Ga0070698_10000258212 175
13 3300005518 Ga0070699_100000688 Ga0070699_10000068815 175
14 3300005536 Ga0070697_100009304 Ga0070697_1000093043 175
15 3300005546 Ga0070696_100100081 Ga0070696_1001000812 175
16 3300025910 Ga0207684_10011737 Ga0207684_100117375 175
17 3300025911 Ga0207654_10629485 Ga0207654_106294851 175
18 3300025922 Ga0207646_10048605 Ga0207646_100486055 175
19 3300044712 Ga0453684_0000344 Ga0453684_0000344_23222_23758 175
20 3300044712 Ga0453684_0013661 Ga0453684_0013661_9804_10340 175
21 3300044712 Ga0453684_0074477 Ga0453684_0074477_1658_2194 175
22 3300009177 Ga0105248_10531520 Ga0105248_105315202 176
23 3300014325 Ga0163163_10073025 Ga0163163_100730252 176
24 3300042435 Ga0439434_0011115 Ga0439434_0011115_1930_2502 176
25 3300046684 Ga0495669_0114133 Ga0495669_0114133_10_669 176
26 3300047445 Ga0495677_0123482 Ga0495677_0123482_16_558 176
27 3300049571 Ga0501034_0062880 Ga0501034_0062880_179_733 178
28 3300005336 Ga0070680_100068735 Ga0070680_1000687352 179
29 3300037853 Ga0436364_0331690 Ga0436364_0331690_22_573 179
30 3300005293 Ga0065715_10461251 Ga0065715_104612512 180
31 3300005338 Ga0068868_100472253 Ga0068868_1004722532 180
32 3300005435 Ga0070714_100106931 Ga0070714_1001069312 180
33 3300005435 Ga0070714_100323979 Ga0070714_1003239792 180
34 3300005439 Ga0070711_100020619 Ga0070711_1000206195 180
35 3300005445 Ga0070708_100051568 Ga0070708_1000515682 180
36 3300005445 Ga0070708_100117337 Ga0070708_1001173372 180
37 3300005467 Ga0070706_100187220 Ga0070706_1001872202 180
38 3300005467 Ga0070706_100293356 Ga0070706_1002933562 180
39 3300005471 Ga0070698_100005766 Ga0070698_1000057663 180
40 3300005518 Ga0070699_100625525 Ga0070699_1006255251 180
41 3300005536 Ga0070697_100229249 Ga0070697_1002292492 180
42 3300005536 Ga0070697_100351090 Ga0070697_1003510902 180
43 3300005539 Ga0068853_100576767 Ga0068853_1005767671 180
44 3300005544 Ga0070686_100730402 Ga0070686_1007304021 180
45 3300005548 Ga0070665_100137949 Ga0070665_1001379492 180
46 3300005842 Ga0068858_100044144 Ga0068858_1000441443 180
47 3300006028 Ga0070717_10194761 Ga0070717_101947612 180
48 3300006173 Ga0070716_100023342 Ga0070716_1000233423 180
49 3300006173 Ga0070716_100050971 Ga0070716_1000509713 180
50 3300006175 Ga0070712_100023047 Ga0070712_1000230475 180
51 3300006237 Ga0097621_100634788 Ga0097621_1006347882 180
52 3300006847 Ga0075431_100753708 Ga0075431_1007537082 180
53 3300006871 Ga0075434_100639590 Ga0075434_1006395902 180
54 3300006914 Ga0075436_100008974 Ga0075436_1000089744 180
55 3300007265 Ga0099794_10018359 Ga0099794_100183593 180
56 3300007265 Ga0099794_10021964 Ga0099794_100219645 180
57 3300007265 Ga0099794_10160409 Ga0099794_101604092 180
58 3300007265 Ga0099794_10303553 Ga0099794_103035532 180
59 3300007788 Ga0099795_10010681 Ga0099795_100106813 180
60 3300009093 Ga0105240_10193621 Ga0105240_101936212 180
61 3300009093 Ga0105240_10229845 Ga0105240_102298452 180
62 3300009098 Ga0105245_10036802 Ga0105245_100368026 180
63 3300009177 Ga0105248_10012185 Ga0105248_100121858 180
64 3300009545 Ga0105237_10124933 Ga0105237_101249333 180
65 3300010375 Ga0105239_10156679 Ga0105239_101566792 180
66 3300013297 Ga0157378_10014474 Ga0157378_100144742 180
67 3300013306 Ga0163162_10371066 Ga0163162_103710661 180
68 3300013308 Ga0157375_10188589 Ga0157375_101885892 180
69 3300014325 Ga0163163_10152777 Ga0163163_101527774 180
70 3300021388 Ga0213875_10000005 Ga0213875_10000005195 180
71 3300024225 Ga0224572_1000130 Ga0224572_10001302 180
72 3300025905 Ga0207685_10222902 Ga0207685_102229021 180
73 3300025910 Ga0207684_10158843 Ga0207684_101588432 180
74 3300025913 Ga0207695_10189187 Ga0207695_101891872 180
75 3300025913 Ga0207695_10396780 Ga0207695_103967802 180
76 3300025914 Ga0207671_10118350 Ga0207671_101183502 180
77 3300025915 Ga0207693_10064932 Ga0207693_100649322 180
78 3300025915 Ga0207693_10118555 Ga0207693_101185552 180
79 3300025915 Ga0207693_10135193 Ga0207693_101351932 180
80 3300025916 Ga0207663_10470254 Ga0207663_104702542 180
81 3300025927 Ga0207687_10246726 Ga0207687_102467261 180
82 3300025928 Ga0207700_10639067 Ga0207700_106390671 180
83 3300025939 Ga0207665_10083955 Ga0207665_100839552 180
84 3300025939 Ga0207665_10105777 Ga0207665_101057773 180
85 3300025939 Ga0207665_10209301 Ga0207665_102093012 180
86 3300025939 Ga0207665_10226613 Ga0207665_102266131 180
87 3300026035 Ga0207703_10533983 Ga0207703_105339831 180
88 3300027671 Ga0209588_1039563 Ga0209588_10395631 180
89 3300027671 Ga0209588_1067848 Ga0209588_10678482 180
90 3300028379 Ga0268266_10040425 Ga0268266_100404253 180
91 3300030878 Ga0265770_1013207 Ga0265770_10132071 180
92 3300031090 Ga0265760_10004593 Ga0265760_100045932 180
93 3300035086 Ga0373934_0024341 Ga0373934_0024341_498_1070 180
94 3300035120 Ga0373957_0136740 Ga0373957_0136740_231_803 180
95 3300035692 Ga0373935_0077549 Ga0373935_0077549_604_1158 180
96 3300035695 Ga0373927_0188647 Ga0373927_0188647_297_863 180
97 3300035725 Ga0373947_0056796 Ga0373947_0056796_1782_2336 180
98 3300036401 Ga0373937_0019203 Ga0373937_0019203_4712_5266 180
99 3300036401 Ga0373937_0127533 Ga0373937_0127533_1544_2116 180
100 3300037068 Ga0373925_0229516 Ga0373925_0229516_441_1007 180
101 3300037853 Ga0436364_0157811 Ga0436364_0157811_360511_361062 180
102 3300037853 Ga0436364_1032849 Ga0436364_1032849_2597_3154 180
103 3300042876 Ga0451577_0905155 Ga0451577_0905155_216_773 180
104 3300046462 Ga0495651_0529836 Ga0495651_0529836_136_708 180
105 3300046472 Ga0495580_0197735 Ga0495580_0197735_293_877 180
106 3300046559 Ga0495667_0279922 Ga0495667_0279922_273_845 180
107 3300046559 Ga0495667_0471002 Ga0495667_0471002_210_764 180
108 3300046679 Ga0495623_0102148 Ga0495623_0102148_1154_1708 180
109 3300047317 Ga0495604_0080524 Ga0495604_0080524_1058_1612 180
110 3300047319 Ga0495674_0139163 Ga0495674_0139163_12_566 180
111 3300047471 Ga0495684_0018587 Ga0495684_0018587_1278_1832 180
112 3300048912 Ga0496109_0476806 Ga0496109_0476806_57_674 180
113 3300048915 Ga0496112_0332837 Ga0496112_0332837_103_720 180
114 3300048915 Ga0496112_0794984 Ga0496112_0794984_131_685 180
115 3300050512 nmdc:mga0n895_641976_c1 nmdc:mga0n895_641976_c1_277_849 180
116 3300050514 nmdc:mga08x19_15988_c1 nmdc:mga08x19_15988_c1_3378_3935 180
117 3300003841 Ga0055541_1001452 Ga0055541_10014522 181
118 3300025225 Ga0209566_100190 Ga0209566_10019045 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08002

DUF1697

Protein of unknown function (DUF1697)

40

177

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.8036 1 177
2hiy-assembly1.cif.gz_B the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7952 2 176
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7881 1 177
2hiy-assembly1.cif.gz_B the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7715 2 176
2rsq-assembly1.cif.gz_A copper(i) loaded form of the first domain of the human copper chaperone for sod1, ccs 0.6629 2 79
ID Description Score Start End Superfamily
af_O06552_36_123_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.963 2 87 3.30.70.1280
af_Q54C13_1_90_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.9569 1 89 3.30.70.1280
af_Q54C13_1_90_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.9366 1 89 3.30.70.1280
af_O06552_36_123_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.9105 2 87 3.30.70.1280
af_Q54D49_1_88_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8907 2 87 3.30.70.1280
ID Description Score Start End GO Terms
AF-A0A4U3BFR7-F1-model_v4 deleted 0.9763 1 79
AF-A0A1I1B1R7-F1-model_v4 Uncharacterized conserved protein, DUF1697 family 0.9755 1 181
AF-A0A4U2ZYR9-F1-model_v4 deleted 0.9736 3 87
AF-A0A7Z1JP37-F1-model_v4 deleted 0.9735 1 94
AF-A0A4U3BFR7-F1-model_v4 deleted 0.9642 1 79

Feature Viewer

pLDDT pTM Quality
92.01 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map