F094537

General Info

Members Datasets Scaffolds Average Seq Length
117 64 116 406

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0107217|Ga0496111_0107217_531_1814
Length 427
Sequence VEGGGGLALTREDALALDARDPLAGFRERFVIADPELLYLDGNSLGRLPAGTRERLNAAIDEWGNGLVTGWHEWIDLPTRVGDALAAGVLGARPGEVLVADSTTVNLYKLACAALDAYSLSAQRALVTDSGNFPTDRYVLEGIAEQRGLELRLFDSADPLLGPQTSDLEDILEDGAVALIVLSHVNYRSGAVADMKALTDLARRYDAHIVWDLSHSAGAVPVNLRENGVELAVGCTYKYLNSGPGGIAYLYVAEELQSGLRTPIWGWFGQAKQFEMERPYEPMEGIGRFLAGTPPILNLAAVESGVAITAEAGIDAIREKSVAQTSLMIELHDEWLAPLGFELGSPRDAARRGSHVALRHDDAWRICRALIERAKVVPDFRGPDSVRLGIAPLYTSYVDVWDAIDRLRGLVERGEHTELDATRARVT

Samples

Sample ID Description Type Environment
1 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
5 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
6 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
9 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
10 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
11 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
15 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
16 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
17 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
25 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
26 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
27 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
28 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
29 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
30 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
31 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
32 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
33 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
34 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
35 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
36 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
37 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
38 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
39 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
40 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
41 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
42 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
43 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
44 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
45 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
46 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
47 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
48 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
49 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
50 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
51 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
52 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
53 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
54 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
55 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
56 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
57 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
58 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
59 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
60 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
61 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
62 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
63 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
64 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 3.42
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10015192 3300003373 Bacteria 1987
2 Ga0070659_100135983 3300005366 Bacteria 1999
3 Ga0070700_100038401 3300005441 Bacteria 2917
4 Ga0068852_100102290 3300005616 Bacteria 2588
5 Ga0081538_10000263 3300005981 Bacteria 59895
6 Ga0081538_10000299 3300005981 Bacteria 57017
7 Ga0081538_10000941 3300005981 Bacteria 31380
8 Ga0081538_10001766 3300005981 Bacteria 21872
9 Ga0081538_10004790 3300005981 Bacteria 12361
10 Ga0081538_10007531 3300005981 Bacteria 9407
11 Ga0081538_10016975 3300005981 Bacteria 5551
12 Ga0081538_10017900 3300005981 Bacteria 5352
13 Ga0081538_10019356 3300005981 Bacteria 5063
14 Ga0081538_10023609 3300005981 Bacteria 4414
15 Ga0081538_10067435 3300005981 Bacteria 1998
16 Ga0081538_10068185 3300005981 Bacteria 1980
17 Ga0081539_10007230 3300005985 Bacteria 10204
18 Ga0075428_100027610 3300006844 Bacteria 6279
19 Ga0075428_100062297 3300006844 Bacteria 4084
20 Ga0075428_100483987 3300006844 Bacteria 1324
21 Ga0075430_100000288 3300006846 Bacteria 35424
22 Ga0075430_100093983 3300006846 Bacteria 2507
23 Ga0075430_100162401 3300006846 Bacteria 1859
24 Ga0075431_100013092 3300006847 Bacteria 8379
25 Ga0111539_10093183 3300009094 Bacteria 3538
26 Ga0111539_10175728 3300009094 Bacteria 2502
27 Ga0114129_10094006 3300009147 Bacteria 4153
28 Ga0105243_10242602 3300009148 Bacteria 1604
29 Ga0157375_10460286 3300013308 Bacteria 1437
30 Ga0157377_10107732 3300014745 Bacteria 1671
31 Ga0207426_1019424 3300025302 Bacteria 2376
32 Ga0207643_10121242 3300025908 Bacteria 1549
33 Ga0207681_10040760 3300025923 Bacteria 3092
34 Ga0207691_10080124 3300025940 Bacteria 2937
35 Ga0207678_10077034 3300026067 Bacteria 2856
36 Ga0207708_10027882 3300026075 Bacteria 4276
37 Ga0207708_10100951 3300026075 Bacteria 2233
38 Ga0207675_100026638 3300026118 Bacteria 5382
39 Ga0207675_100039592 3300026118 Bacteria 4399
40 Ga0207675_100124686 3300026118 Bacteria 2439
41 Ga0207675_100285252 3300026118 Bacteria 1605
42 Ga0268266_10257298 3300028379 Bacteria 1617
43 Ga0307513_10033256 3300031456 Bacteria 5797
44 Ga0307406_10007154 3300031901 Bacteria 6182
45 Ga0307406_10069008 3300031901 Bacteria 2310
46 Ga0307407_10089156 3300031903 Bacteria 1886
47 Ga0307409_100045106 3300031995 Bacteria 3326
48 Ga0307409_100297495 3300031995 Bacteria 1500
49 Ga0307409_100299603 3300031995 Bacteria 1495
50 Ga0466966_0003665 3300044684 Bacteria 10138
51 Ga0466963_0041233 3300044694 Bacteria 3027
52 Ga0466963_0106655 3300044694 Bacteria 1921
53 Ga0466964_0067065 3300044706 Bacteria 1507
54 Ga0466957_0022716 3300044842 Bacteria 3703
55 Ga0466957_0104463 3300044842 Bacteria 1789
56 Ga0466967_0022183 3300045976 Bacteria 5174
57 Ga0466967_0028773 3300045976 Bacteria 4644
58 Ga0466967_0033309 3300045976 Bacteria 4359
59 Ga0466967_0073289 3300045976 Bacteria 3072
60 Ga0466967_0211952 3300045976 Bacteria 1837
61 Ga0466967_0357535 3300045976 Bacteria 1414
62 Ga0466967_0361698 3300045976 Bacteria 1406
63 Ga0496106_0387604 3300048909 Bacteria 1123
64 Ga0496109_0128589 3300048912 Bacteria 2363
65 Ga0496111_0107217 3300048914 Bacteria 2057
66 Ga0496111_0245374 3300048914 Bacteria 1330
67 Ga0501033_0094220 3300049570 Bacteria 2190
68 Ga0501036_0101332 3300049572 Bacteria 2436
69 Ga0501037_0176091 3300049573 Bacteria 1519
70 Ga0501038_0034902 3300049574 Bacteria 4420
71 Ga0501038_0061686 3300049574 Bacteria 3206
72 Ga0501039_0007059 3300049575 Bacteria 8553
73 Ga0501039_0056293 3300049575 Bacteria 3046
74 Ga0501040_0044674 3300049576 Bacteria 3021
75 Ga0501040_0051620 3300049576 Bacteria 2813
76 Ga0501040_0091200 3300049576 Bacteria 2118
77 Ga0501041_0037776 3300049577 Bacteria 2927
78 Ga0501042_0024134 3300049578 Bacteria 4263
79 Ga0501042_0024170 3300049578 Bacteria 4261
80 Ga0501042_0034265 3300049578 Bacteria 3601
81 Ga0501046_0059074 3300049580 Bacteria 3005
82 Ga0501047_0070103 3300049581 Bacteria 3375
83 Ga0501048_0033514 3300049582 Bacteria 3710
84 Ga0501069_0035227 3300049585 Bacteria 2757
85 Ga0501070_0080161 3300049586 Bacteria 2701
86 Ga0501071_0056918 3300049587 Bacteria 2825
87 Ga0501071_0092175 3300049587 Bacteria 2226
88 Ga0501071_0136600 3300049587 Bacteria 1824
89 Ga0501072_0025174 3300049588 Bacteria 4634
90 Ga0501072_0110745 3300049588 Bacteria 2185
91 Ga0501073_0059180 3300049589 Bacteria 2677
92 Ga0501074_0032194 3300049590 Bacteria 3799
93 Ga0501074_0216271 3300049590 Bacteria 1365
94 Ga0501075_0009147 3300049591 Bacteria 6924
95 Ga0501075_0037371 3300049591 Bacteria 3627
96 Ga0501075_0109536 3300049591 Bacteria 2100
97 Ga0501076_0032443 3300049592 Bacteria 4076
98 Ga0501076_0055306 3300049592 Bacteria 3147
99 Ga0501076_0063663 3300049592 Bacteria 2939
100 Ga0501076_0176891 3300049592 Bacteria 1739
101 Ga0501077_0057983 3300049593 Bacteria 2458
102 Ga0501080_0051694 3300049742 Bacteria 3824
103 Ga0501080_0105954 3300049742 Bacteria 2606
104 Ga0501035_0111428 3300049822 Bacteria 2398
105 nmdc:mga05p37_17002_c1 3300050507 Bacteria 8772
106 nmdc:mga05p37_341708_c1 3300050507 Bacteria 1765
107 nmdc:mga0qj67_22831_c1 3300050509 Bacteria 4807
108 nmdc:mga0qj67_275552_c1 3300050509 Bacteria 1364
109 nmdc:mga08y16_240012_c1 3300050511 Bacteria 1873
110 nmdc:mga08y16_60329_c1 3300050511 Bacteria 3962
111 nmdc:mga0n895_289333_c1 3300050512 Bacteria 1661
112 Ga0501084_0072464 3300054114 Bacteria 2885
113 Ga0501084_0202571 3300054114 Bacteria 1675
114 Ga0501082_0028325 3300060353 Bacteria 4827
115 Ga0501082_0064745 3300060353 Bacteria 3148
116 Ga0530510_0010008 3300061734 Bacteria 6653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028379 Ga0268266_10257298 Ga0268266_102572982 327
2 3300013308 Ga0157375_10460286 Ga0157375_104602862 354
3 3300048909 Ga0496106_0387604 Ga0496106_0387604_16_1113 359
4 3300031456 Ga0307513_10033256 Ga0307513_100332564 364
5 3300049580 Ga0501046_0059074 Ga0501046_0059074_18_1136 369
6 3300049581 Ga0501047_0070103 Ga0501047_0070103_767_1948 376
7 3300049575 Ga0501039_0007059 Ga0501039_0007059_36_1217 390
8 3300049578 Ga0501042_0034265 Ga0501042_0034265_313_1494 390
9 3300049591 Ga0501075_0009147 Ga0501075_0009147_1764_2945 390
10 3300031995 Ga0307409_100297495 Ga0307409_1002974951 395
11 3300045976 Ga0466967_0022183 Ga0466967_0022183_2882_4078 395
12 iso_pu_bacteria 2857481737 2857483520 395
13 3300026075 Ga0207708_10027882 Ga0207708_100278824 396
14 3300026075 Ga0207708_10100951 Ga0207708_101009512 396
15 3300026118 Ga0207675_100039592 Ga0207675_1000395924 396
16 3300044684 Ga0466966_0003665 Ga0466966_0003665_7361_8572 396
17 3300044694 Ga0466963_0041233 Ga0466963_0041233_605_1807 396
18 3300044694 Ga0466963_0106655 Ga0466963_0106655_587_1798 396
19 3300044706 Ga0466964_0067065 Ga0466964_0067065_268_1479 396
20 3300044842 Ga0466957_0022716 Ga0466957_0022716_1257_2468 396
21 3300044842 Ga0466957_0104463 Ga0466957_0104463_537_1748 396
22 3300045976 Ga0466967_0033309 Ga0466967_0033309_2176_3387 396
23 3300045976 Ga0466967_0211952 Ga0466967_0211952_136_1338 396
24 3300045976 Ga0466967_0361698 Ga0466967_0361698_80_1282 396
25 3300005981 Ga0081538_10001766 Ga0081538_1000176618 397
26 3300006844 Ga0075428_100483987 Ga0075428_1004839871 397
27 3300009094 Ga0111539_10093183 Ga0111539_100931832 397
28 3300031901 Ga0307406_10069008 Ga0307406_100690082 397
29 3300031995 Ga0307409_100299603 Ga0307409_1002996031 397
30 3300050507 nmdc:mga05p37_341708_c1 nmdc:mga05p37_341708_c1_210_1412 397
31 3300050511 nmdc:mga08y16_240012_c1 nmdc:mga08y16_240012_c1_400_1608 397
32 3300050511 nmdc:mga08y16_60329_c1 nmdc:mga08y16_60329_c1_802_2004 397
33 3300005616 Ga0068852_100102290 Ga0068852_1001022902 398
34 3300005985 Ga0081539_10007230 Ga0081539_1000723010 398
35 3300025302 Ga0207426_1019424 Ga0207426_10194241 398
36 3300026067 Ga0207678_10077034 Ga0207678_100770342 398
37 3300026118 Ga0207675_100026638 Ga0207675_1000266386 398
38 3300031901 Ga0307406_10007154 Ga0307406_100071545 398
39 3300031995 Ga0307409_100045106 Ga0307409_1000451062 398
40 3300050512 nmdc:mga0n895_289333_c1 nmdc:mga0n895_289333_c1_103_1317 398
41 3300048912 Ga0496109_0128589 Ga0496109_0128589_257_1501 399
42 3300049570 Ga0501033_0094220 Ga0501033_0094220_871_2082 400
43 3300009094 Ga0111539_10175728 Ga0111539_101757283 401
44 3300014745 Ga0157377_10107732 Ga0157377_101077322 401
45 3300026118 Ga0207675_100285252 Ga0207675_1002852521 401
46 3300045976 Ga0466967_0357535 Ga0466967_0357535_123_1340 401
47 3300049573 Ga0501037_0176091 Ga0501037_0176091_139_1356 401
48 3300049574 Ga0501038_0034902 Ga0501038_0034902_2942_4159 401
49 3300049576 Ga0501040_0091200 Ga0501040_0091200_45_1262 401
50 3300049578 Ga0501042_0024134 Ga0501042_0024134_2086_3303 401
51 3300049586 Ga0501070_0080161 Ga0501070_0080161_819_2036 401
52 3300049587 Ga0501071_0136600 Ga0501071_0136600_27_1244 401
53 3300049588 Ga0501072_0110745 Ga0501072_0110745_231_1448 401
54 3300049589 Ga0501073_0059180 Ga0501073_0059180_1163_2380 401
55 3300049591 Ga0501075_0037371 Ga0501075_0037371_2311_3528 401
56 3300049593 Ga0501077_0057983 Ga0501077_0057983_187_1404 401
57 3300049742 Ga0501080_0051694 Ga0501080_0051694_2320_3537 401
58 3300049822 Ga0501035_0111428 Ga0501035_0111428_72_1289 401
59 3300060353 Ga0501082_0064745 Ga0501082_0064745_194_1411 401
60 3300049585 Ga0501069_0035227 Ga0501069_0035227_769_1989 402
61 3300049742 Ga0501080_0105954 Ga0501080_0105954_83_1303 402
62 3300005366 Ga0070659_100135983 Ga0070659_1001359831 403
63 3300005441 Ga0070700_100038401 Ga0070700_1000384013 403
64 3300006846 Ga0075430_100162401 Ga0075430_1001624012 403
65 3300009148 Ga0105243_10242602 Ga0105243_102426022 403
66 3300025923 Ga0207681_10040760 Ga0207681_100407603 403
67 3300025940 Ga0207691_10080124 Ga0207691_100801242 403
68 3300026118 Ga0207675_100124686 Ga0207675_1001246862 403
69 3300049574 Ga0501038_0061686 Ga0501038_0061686_1506_2741 403
70 3300049575 Ga0501039_0056293 Ga0501039_0056293_1003_2238 403
71 3300049576 Ga0501040_0051620 Ga0501040_0051620_1387_2622 403
72 3300049578 Ga0501042_0024170 Ga0501042_0024170_627_1862 403
73 3300049582 Ga0501048_0033514 Ga0501048_0033514_1115_2350 403
74 3300049587 Ga0501071_0092175 Ga0501071_0092175_266_1501 403
75 3300049588 Ga0501072_0025174 Ga0501072_0025174_2041_3276 403
76 3300049592 Ga0501076_0032443 Ga0501076_0032443_1387_2622 403
77 3300060353 Ga0501082_0028325 Ga0501082_0028325_218_1453 403
78 3300025908 Ga0207643_10121242 Ga0207643_101212421 404
79 3300049577 Ga0501041_0037776 Ga0501041_0037776_1182_2423 405
80 3300049587 Ga0501071_0056918 Ga0501071_0056918_206_1447 405
81 3300049590 Ga0501074_0216271 Ga0501074_0216271_88_1329 405
82 3300049591 Ga0501075_0109536 Ga0501075_0109536_409_1650 405
83 3300049592 Ga0501076_0055306 Ga0501076_0055306_688_1929 405
84 3300049592 Ga0501076_0176891 Ga0501076_0176891_390_1631 405
85 3300054114 Ga0501084_0072464 Ga0501084_0072464_887_2128 405
86 3300005981 Ga0081538_10007531 Ga0081538_1000753113 408
87 3300005981 Ga0081538_10019356 Ga0081538_100193563 408
88 3300005981 Ga0081538_10068185 Ga0081538_100681852 408
89 3300031903 Ga0307407_10089156 Ga0307407_100891562 408
90 3300049572 Ga0501036_0101332 Ga0501036_0101332_197_1423 408
91 3300049576 Ga0501040_0044674 Ga0501040_0044674_387_1613 408
92 3300049590 Ga0501074_0032194 Ga0501074_0032194_2303_3529 408
93 3300049592 Ga0501076_0063663 Ga0501076_0063663_647_1873 408
94 3300054114 Ga0501084_0202571 Ga0501084_0202571_407_1633 408
95 3300061734 Ga0530510_0010008 Ga0530510_0010008_4171_5397 408
96 3300003373 JGI25407J50210_10015192 JGI25407J50210_100151922 412
97 3300005981 Ga0081538_10000263 Ga0081538_1000026324 412
98 3300005981 Ga0081538_10000299 Ga0081538_100002995 412
99 3300005981 Ga0081538_10000941 Ga0081538_1000094128 412
100 3300005981 Ga0081538_10004790 Ga0081538_1000479012 412
101 3300005981 Ga0081538_10016975 Ga0081538_100169754 412
102 3300005981 Ga0081538_10017900 Ga0081538_100179006 412
103 3300005981 Ga0081538_10023609 Ga0081538_100236095 412
104 3300005981 Ga0081538_10067435 Ga0081538_100674352 412
105 3300006844 Ga0075428_100027610 Ga0075428_1000276102 412
106 3300006844 Ga0075428_100062297 Ga0075428_1000622974 412
107 3300006846 Ga0075430_100000288 Ga0075430_10000028835 412
108 3300006846 Ga0075430_100093983 Ga0075430_1000939833 412
109 3300006847 Ga0075431_100013092 Ga0075431_1000130926 412
110 3300009147 Ga0114129_10094006 Ga0114129_100940064 412
111 3300045976 Ga0466967_0028773 Ga0466967_0028773_3056_4309 412
112 3300045976 Ga0466967_0073289 Ga0466967_0073289_802_2061 412
113 3300048914 Ga0496111_0107217 Ga0496111_0107217_531_1814 412
114 3300048914 Ga0496111_0245374 Ga0496111_0245374_30_1295 412
115 3300050507 nmdc:mga05p37_17002_c1 nmdc:mga05p37_17002_c1_6452_7693 412
116 3300050509 nmdc:mga0qj67_22831_c1 nmdc:mga0qj67_22831_c1_1171_2445 412
117 3300050509 nmdc:mga0qj67_275552_c1 nmdc:mga0qj67_275552_c1_96_1337 412

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22580

KYNU_C

Kynureninase C-terminal domain

317

407

0.98

PF00266

Aminotran_5

Aminotransferase class-V

83

364

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qz9-assembly1.cif.gz_A-2 the three dimensional structure of kynureninase from pseudomonas fluorescens 0.9319 2 401
1qz9-assembly1.cif.gz_A-2 the three dimensional structure of kynureninase from pseudomonas fluorescens 0.9207 2 401
7s3v-assembly1.cif.gz_A structure of hskynase_66, an evolved variant of human kynureninase with greatly increased activity towards kynurenine 0.9072 3 397
2hzp-assembly1.cif.gz_A-2 crystal structure of homo sapiens kynureninase 0.8961 3 397
3e9k-assembly1.cif.gz_A-2 crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex 0.8896 3 397
ID Description Score Start End Superfamily
1qz9A01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9663 299 401 3.90.1150.10
af_Q54Q04_346_448_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9127 296 392 3.90.1150.10
af_Q4DQ63_347_462_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9096 304 392 3.90.1150.10
1qz9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9009 42 296 3.40.640.10
af_P70712_80_352_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8988 42 297 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A7W1R3G3-F1-model_v4 Kynureninase 0.9811 279 399 GO:0005737
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A388NZS2-F1-model_v4 Kynureninase 0.9771 195 403 GO:0005737
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A3N5RJ06-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9756 214 412 GO:0005737
GO:0008483
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A7W0PD12-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9739 180 398 GO:0005737
GO:0008483
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A7W1R3G3-F1-model_v4 Kynureninase 0.9731 279 399 GO:0005737
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420

Feature Viewer

pLDDT pTM Quality
94.42 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map