F093998

General Info

Members Datasets Scaffolds Average Seq Length
117 53 234 281

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0001450|Ga0451577_0001450_15517_16506
Length 329
Sequence MLFGVLKHKPGSGSSAPVFLLVGCRQFCYLFAIIYENDPHCTKGARPMKFTKMHGAGNDYVYVNCFAEPVENPADVAIKVSNRNFGIGSDGLILILPSDKADVRMRMFNSDGSESEMCGNGIRCVAKYAYDHGIVSKKEISAETGAGILTLQLFTGSDNKVERVRVNMGKPRLTKAEIPMLGEPQGAQTVNQPLNILHTTFNITTVSMGNPHCVIFVDDVETFQVEKYGPLIENHDLFPRRTNVEFVQIISRTEVRQRTWERGAGETLACGTGASAVCVAGALNGLTEKRILNHLSGGDLELEWAEDGHLYMTGPATEVFSGEINLTRL

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
11 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
19 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
23 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
24 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
25 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
26 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
27 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
28 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
29 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
30 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
31 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
32 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
33 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
34 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
35 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
36 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
37 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
38 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
39 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
40 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
41 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
42 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
43 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
44 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
45 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
46 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
47 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
48 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
49 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
50 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
51 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
52 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
53 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 95.73
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0001450 3300042876 Bacteria 31546
2 Ga0065712_10068474 3300005290 Bacteria 10408
3 Ga0065707_10115888 3300005295 Bacteria 2254
4 Ga0065707_10166851 3300005295 Bacteria 1515
5 Ga0070668_100410385 3300005347 Bacteria 1158
6 Ga0070714_100331565 3300005435 Bacteria 1425
7 Ga0070706_100108574 3300005467 Bacteria 2582
8 Ga0070698_100019102 3300005471 Bacteria 7203
9 Ga0070698_100435422 3300005471 Bacteria 1246
10 Ga0070699_100054389 3300005518 Bacteria 3465
11 Ga0070686_100019897 3300005544 Bacteria 3966
12 Ga0068863_100890402 3300005841 Bacteria 890
13 Ga0068860_100683378 3300005843 Bacteria 1036
14 Ga0081538_10000646 3300005981 Bacteria 38553
15 Ga0081538_10044687 3300005981 Bacteria 2759
16 Ga0081538_10169918 3300005981 Bacteria 953
17 Ga0075428_100075710 3300006844 Bacteria 3675
18 Ga0075428_100245149 3300006844 Bacteria 1932
19 Ga0075430_100024375 3300006846 Bacteria 5150
20 Ga0075431_100051856 3300006847 Bacteria 4230
21 Ga0075431_100101032 3300006847 Bacteria 2976
22 Ga0111539_10309907 3300009094 Bacteria 1837
23 Ga0111539_10616386 3300009094 Bacteria 1264
24 Ga0157370_10077006 3300013104 Bacteria 3142
25 Ga0163162_10154211 3300013306 Bacteria 2416
26 Ga0207664_10416412 3300025929 Bacteria 1196
27 Ga0207670_10105897 3300025936 Bacteria 2016
28 Ga0268264_10633534 3300028381 Bacteria 1057
29 Ga0265338_10016106 3300028800 Bacteria 8157
30 Ga0265325_10000075 3300031241 Bacteria 69697
31 Ga0265339_10026553 3300031249 Bacteria 3315
32 Ga0265331_10000318 3300031250 Bacteria 52276
33 Ga0265331_10074283 3300031250 Unclassified 1587
34 Ga0265313_10001907 3300031595 Bacteria 18912
35 Ga0265314_10000032 3300031711 Bacteria 259870
36 Ga0265314_10001222 3300031711 Bacteria 29436
37 Ga0265342_10004178 3300031712 Bacteria 11492
38 Ga0316577_10049914 3300031733 Bacteria 2335
39 Ga0307413_10049016 3300031824 Bacteria 2529
40 Ga0307410_10041234 3300031852 Bacteria 3043
41 Ga0307406_10095914 3300031901 Bacteria 2008
42 Ga0307415_100330792 3300032126 Bacteria 1275
43 Ga0307415_100341988 3300032126 Bacteria 1256
44 Ga0373928_0005232 3300035084 Bacteria 2474
45 Ga0373932_0003975 3300035112 Bacteria 3521
46 Ga0316574_0116973 3300035398 Bacteria 1710
47 Ga0373937_0173896 3300036401 Bacteria 2021
48 Ga0395905_0012055 3300037471 Bacteria 8334
49 Ga0400484_28888 3300038725 Bacteria 2416
50 Ga0400484_38185 3300038725 Bacteria 8325
51 Ga0400490_14744 3300038726 Bacteria 4902
52 Ga0400489_69546 3300039093 Bacteria 1555
53 Ga0451577_0000188 3300042876 Bacteria 131320
54 Ga0451577_0000706 3300042876 Bacteria 52148
55 Ga0451577_0003683 3300042876 Bacteria 16781
56 Ga0451577_0018718 3300042876 Bacteria 6373
57 Ga0451577_0077897 3300042876 Bacteria 2956
58 Ga0451577_0150738 3300042876 Bacteria 2092
59 Ga0451577_0151182 3300042876 Bacteria 2089
60 Ga0451577_0397850 3300042876 Bacteria 1250
61 Ga0453683_0000018 3300044673 Bacteria 309212
62 Ga0453683_0000020 3300044673 Bacteria 286813
63 Ga0453683_0000068 3300044673 Bacteria 164042
64 Ga0453683_0000172 3300044673 Bacteria 89472
65 Ga0453683_0000630 3300044673 Bacteria 38405
66 Ga0453683_0000880 3300044673 Bacteria 28834
67 Ga0453683_0004360 3300044673 Bacteria 10063
68 Ga0453683_0009633 3300044673 Bacteria 6443
69 Ga0453683_0021910 3300044673 Bacteria 4076
70 Ga0453683_0093191 3300044673 Bacteria 1889
71 Ga0453683_0093797 3300044673 Bacteria 1883
72 Ga0453683_0104187 3300044673 Bacteria 1782
73 Ga0453684_0000612 3300044712 Bacteria 131319
74 Ga0453684_0000996 3300044712 Bacteria 92235
75 Ga0453684_0001210 3300044712 Bacteria 79441
76 Ga0453684_0001579 3300044712 Bacteria 63020
77 Ga0453684_0005514 3300044712 Bacteria 24972
78 Ga0453684_0024128 3300044712 Bacteria 8908
79 Ga0453684_0040210 3300044712 Bacteria 6357
80 Ga0453684_0042903 3300044712 Bacteria 6088
81 Ga0453684_0043199 3300044712 Bacteria 6062
82 Ga0453684_0054495 3300044712 Bacteria 5208
83 Ga0453684_0055436 3300044712 Bacteria 5153
84 Ga0453684_0084447 3300044712 Bacteria 3948
85 Ga0453684_0104707 3300044712 Bacteria 3453
86 Ga0453684_0188651 3300044712 Bacteria 2413
87 Ga0453684_0229755 3300044712 Bacteria 2142
88 Ga0453684_0244857 3300044712 Bacteria 2062
89 Ga0453684_0282748 3300044712 Bacteria 1891
90 Ga0453684_0290581 3300044712 Bacteria 1861
91 Ga0453684_0327510 3300044712 Bacteria 1733
92 Ga0453684_0538677 3300044712 Bacteria 1287
93 Ga0451576_0000031 3300045051 Bacteria 399742
94 Ga0451576_0001553 3300045051 Bacteria 38677
95 Ga0451576_0003045 3300045051 Bacteria 23611
96 Ga0451576_0005205 3300045051 Bacteria 16433
97 Ga0451576_0011869 3300045051 Bacteria 9858
98 Ga0451576_0040101 3300045051 Bacteria 4958
99 Ga0451576_0059662 3300045051 Bacteria 3982
100 Ga0451576_0120716 3300045051 Bacteria 2729
101 Ga0451576_0295172 3300045051 Bacteria 1695
102 Ga0451576_0317794 3300045051 Bacteria 1629
103 Ga0451576_0374055 3300045051 Bacteria 1493
104 Ga0495636_0000684 3300047318 Bacteria 12446
105 Ga0501034_0022231 3300049571 Bacteria 6463
106 Ga0501034_0204357 3300049571 Bacteria 1932
107 Ga0501036_0385382 3300049572 Bacteria 1170
108 Ga0501083_0055113 3300049744 Bacteria 2667
109 Ga0501083_0202464 3300049744 Bacteria 1295
110 nmdc:mga05p37_538144_c1 3300050507 Bacteria 1332
111 nmdc:mga0qj67_21410_c1 3300050509 Bacteria 4960
112 nmdc:mga0qj67_381943_c1 3300050509 Bacteria 1137
113 nmdc:mga06r32_110981_c1 3300050510 Bacteria 2698
114 nmdc:mga06r32_224222_c1 3300050510 Bacteria 1868
115 nmdc:mga06r32_79301_c1 3300050510 Bacteria 3194
116 nmdc:mga08y16_455069_c1 3300050511 Bacteria 1305
117 2688391476 2687453341 Bacteria 6534136
118 Ga0451577_0001450
119 Ga0065712_10068474
120 Ga0065707_10115888
121 Ga0065707_10166851
122 Ga0070668_100410385
123 Ga0070714_100331565
124 Ga0070706_100108574
125 Ga0070698_100019102
126 Ga0070698_100435422
127 Ga0070699_100054389
128 Ga0070686_100019897
129 Ga0068863_100890402
130 Ga0068860_100683378
131 Ga0081538_10000646
132 Ga0081538_10044687
133 Ga0081538_10169918
134 Ga0075428_100075710
135 Ga0075428_100245149
136 Ga0075430_100024375
137 Ga0075431_100051856
138 Ga0075431_100101032
139 Ga0111539_10309907
140 Ga0111539_10616386
141 Ga0157370_10077006
142 Ga0163162_10154211
143 Ga0207664_10416412
144 Ga0207670_10105897
145 Ga0268264_10633534
146 Ga0265338_10016106
147 Ga0265325_10000075
148 Ga0265339_10026553
149 Ga0265331_10000318
150 Ga0265331_10074283
151 Ga0265313_10001907
152 Ga0265314_10000032
153 Ga0265314_10001222
154 Ga0265342_10004178
155 Ga0316577_10049914
156 Ga0307413_10049016
157 Ga0307410_10041234
158 Ga0307406_10095914
159 Ga0307415_100330792
160 Ga0307415_100341988
161 Ga0373928_0005232
162 Ga0373932_0003975
163 Ga0316574_0116973
164 Ga0373937_0173896
165 Ga0395905_0012055
166 Ga0400484_28888
167 Ga0400484_38185
168 Ga0400490_14744
169 Ga0400489_69546
170 Ga0451577_0000188
171 Ga0451577_0000706
172 Ga0451577_0003683
173 Ga0451577_0018718
174 Ga0451577_0077897
175 Ga0451577_0150738
176 Ga0451577_0151182
177 Ga0451577_0397850
178 Ga0453683_0000018
179 Ga0453683_0000020
180 Ga0453683_0000068
181 Ga0453683_0000172
182 Ga0453683_0000630
183 Ga0453683_0000880
184 Ga0453683_0004360
185 Ga0453683_0009633
186 Ga0453683_0021910
187 Ga0453683_0093191
188 Ga0453683_0093797
189 Ga0453683_0104187
190 Ga0453684_0000612
191 Ga0453684_0000996
192 Ga0453684_0001210
193 Ga0453684_0001579
194 Ga0453684_0005514
195 Ga0453684_0024128
196 Ga0453684_0040210
197 Ga0453684_0042903
198 Ga0453684_0043199
199 Ga0453684_0054495
200 Ga0453684_0055436
201 Ga0453684_0084447
202 Ga0453684_0104707
203 Ga0453684_0188651
204 Ga0453684_0229755
205 Ga0453684_0244857
206 Ga0453684_0282748
207 Ga0453684_0290581
208 Ga0453684_0327510
209 Ga0453684_0538677
210 Ga0451576_0000031
211 Ga0451576_0001553
212 Ga0451576_0003045
213 Ga0451576_0005205
214 Ga0451576_0011869
215 Ga0451576_0040101
216 Ga0451576_0059662
217 Ga0451576_0120716
218 Ga0451576_0295172
219 Ga0451576_0317794
220 Ga0451576_0374055
221 Ga0495636_0000684
222 Ga0501034_0022231
223 Ga0501034_0204357
224 Ga0501036_0385382
225 Ga0501083_0055113
226 Ga0501083_0202464
227 nmdc:mga05p37_538144_c1
228 nmdc:mga0qj67_21410_c1
229 nmdc:mga0qj67_381943_c1
230 nmdc:mga06r32_110981_c1
231 nmdc:mga06r32_224222_c1
232 nmdc:mga06r32_79301_c1
233 nmdc:mga08y16_455069_c1
234 2688391476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

204

319

0.97

PF01678

DAP_epimerase

Diaminopimelate epimerase

50

174

0.94

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

49

279

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2otn-assembly1.cif.gz_A crystal structure of the catalytically active form of diaminopimelate epimerase from bacillus anthracis 0.9488 2 275
5ha4-assembly1.cif.gz_A structure of a diaminopimelate epimerase from acinetobacter baumannii 0.9437 1 275
6d13-assembly1.cif.gz_A crystal structure of e.coli rpph-dapf complex 0.9319 1 279
2otn-assembly1.cif.gz_A crystal structure of the catalytically active form of diaminopimelate epimerase from bacillus anthracis 0.9291 2 275
4ik0-assembly1.cif.gz_A crystal structure of diaminopimelate epimerase y268a mutant from escherichia coli 0.9275 1 279
ID Description Score Start End Superfamily
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9654 153 265 3.10.310.10
2otnA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9586 2 121 3.10.310.10
af_C6T990_209_343_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9546 142 261 3.10.310.10
af_P0A6K1_1_112_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9427 1 109 3.10.310.10
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9329 153 265 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A517U1C9-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9942 1 279 GO:0005829
GO:0008837
GO:0009089
AF-A0A177R0V8-F1-model_v4 deleted 0.9925 1 279
AF-A0A517U1C9-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9906 1 279 GO:0005829
GO:0008837
GO:0009089
AF-T5LJY7-F1-model_v4 deleted 0.9892 1 127
AF-A0A177R0V8-F1-model_v4 deleted 0.9889 1 279

Map