F090124

General Info

Members Datasets Scaffolds Average Seq Length
116 85 110 315

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0092050|Ga0501047_0092050_512_1525
Length 337
Sequence MDLSQLQQYLPAGIDPAFLLISIAAFVGVATLVGAIAFIMRDYGTTKAEDRLQILAGLKTPELEARGLIKDAIVREGVEGLTGRLHKALSRIGNLQALFDQSDSPIKPDVFFMISAVLGALAVVAGWFARSPLALFPVLFFMGAVMPLTWLIFRRNGRFKKFAKQLPDALELVGRALRSGHSLASGLHVVVQEMPDPISMEFSMVYEEQNLGIPIEQALKNMLKRMPNLDLKFFVTAVAIQRQAGGDLAEILDKIGYIIRERFKILGQVQALTGEGRISGVVLMALPIALFFVVLHMNPGYVMLLFTDPLGRKMIIAAAFLQVLGAVTIKKIINIKV

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
3 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
4 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
5 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
6 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
45 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
46 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
47 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
50 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
51 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
52 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
55 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
56 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
57 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
58 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
59 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
60 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
61 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
68 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
69 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
70 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
71 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
72 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
75 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
76 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
77 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
78 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
79 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
80 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
81 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
82 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
83 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
84 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
85 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.97
Metatranscriptomes 0.86
Isolates 5.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.45
Nodule 0
Rhizoplane 2.59
Rhizosphere 90.52
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_1498203 2162886011 Bacteria 1752
2 rootH2_10176483 3300003320 Bacteria 1147
3 Ga0065704_10083345 3300005289 Bacteria 3478
4 Ga0065712_10072602 3300005290 Bacteria 4686
5 Ga0065707_10142966 3300005295 Bacteria 1745
6 Ga0070680_100381507 3300005336 Bacteria 1200
7 Ga0070689_100205025 3300005340 Unclassified 1612
8 Ga0070714_100134572 3300005435 Bacteria 2212
9 Ga0070713_100112198 3300005436 Bacteria 2379
10 Ga0070679_100427578 3300005530 Bacteria 1269
11 Ga0068853_100075952 3300005539 Bacteria 2933
12 Ga0070686_100163927 3300005544 Unclassified 1567
13 Ga0070665_100000481 3300005548 Bacteria 57473
14 Ga0070665_100163522 3300005548 Bacteria 2228
15 Ga0068855_100198304 3300005563 Bacteria 2261
16 Ga0068862_100275165 3300005844 Bacteria 1541
17 Ga0081455_10053733 3300005937 Bacteria 3439
18 Ga0081539_10145302 3300005985 Bacteria 1147
19 Ga0070717_10073705 3300006028 Bacteria 2854
20 Ga0075365_10225314 3300006038 Bacteria 1315
21 Ga0075428_100008718 3300006844 Bacteria 11251
22 Ga0075428_100012606 3300006844 Bacteria 9399
23 Ga0075428_100022847 3300006844 Bacteria 6919
24 Ga0075428_100115955 3300006844 Bacteria 2918
25 Ga0075431_100227107 3300006847 Unclassified 1903
26 Ga0075431_100249393 3300006847 Unclassified 1804
27 Ga0075429_100184728 3300006880 Bacteria 1827
28 Ga0111539_10412419 3300009094 Bacteria 1573
29 Ga0105248_10124373 3300009177 Bacteria 2909
30 Ga0105237_10059655 3300009545 Bacteria 3816
31 Ga0105249_10104012 3300009553 Bacteria 2675
32 Ga0105239_10296293 3300010375 Bacteria 1821
33 Ga0213873_10030373 3300021358 Bacteria 1337
34 Ga0207707_10381788 3300025912 Bacteria 1211
35 Ga0207660_10191910 3300025917 Bacteria 1591
36 Ga0207700_10018217 3300025928 Bacteria 4713
37 Ga0207670_10105125 3300025936 Bacteria 2023
38 Ga0207712_10108218 3300025961 Bacteria 2080
39 Ga0207639_10053612 3300026041 Bacteria 3078
40 Ga0207708_10240111 3300026075 Bacteria 1457
41 Ga0268266_10000579 3300028379 Bacteria 50615
42 Ga0268266_10016496 3300028379 Bacteria 6315
43 Ga0268266_10319987 3300028379 Bacteria 1452
44 Ga0265338_10005693 3300028800 Bacteria 16119
45 Ga0265338_10182735 3300028800 Bacteria 1597
46 Ga0265760_10002606 3300031090 Bacteria 5271
47 Ga0265325_10000182 3300031241 Bacteria 44912
48 Ga0265339_10000130 3300031249 Bacteria 62250
49 Ga0265331_10000148 3300031250 Bacteria 90823
50 Ga0265313_10008907 3300031595 Bacteria 6597
51 Ga0265314_10000315 3300031711 Bacteria 68251
52 Ga0373925_0331745 3300037068 Bacteria 1232
53 Ga0436360_0411266 3300039438 Bacteria 2372
54 Ga0436360_0458164 3300039438 Bacteria 2353
55 Ga0436361_0103922 3300039447 Bacteria 4504
56 Ga0436361_0389502 3300039447 Bacteria 1966
57 Ga0436362_0688675 3300039453 Bacteria 4527
58 Ga0466963_0076680 3300044694 Bacteria 2258
59 Ga0495651_0168190 3300046462 Unclassified 1564
60 Ga0495587_0065201 3300046536 Bacteria 2127
61 Ga0495604_0057226 3300047317 Bacteria 2998
62 Ga0495674_0419884 3300047319 Unclassified 1078
63 Ga0496104_0224752 3300048907 Bacteria 1789
64 Ga0496108_0107013 3300048911 Bacteria 2388
65 Ga0496115_0064538 3300048918 Bacteria 2956
66 Ga0501033_0010724 3300049570 Bacteria 7025
67 Ga0501034_0001498 3300049571 Bacteria 30698
68 Ga0501034_0005272 3300049571 Bacteria 14185
69 Ga0501034_0032974 3300049571 Bacteria 5259
70 Ga0501034_0040074 3300049571 Bacteria 4743
71 Ga0501034_0075373 3300049571 Bacteria 3381
72 Ga0501034_0092721 3300049571 Bacteria 3017
73 Ga0501034_0092825 3300049571 Bacteria 3015
74 Ga0501034_0125794 3300049571 Bacteria 2549
75 Ga0501034_0194223 3300049571 Bacteria 1991
76 Ga0501041_0100075 3300049577 Bacteria 1794
77 Ga0501043_0027247 3300049579 Bacteria 4487
78 Ga0501043_0098683 3300049579 Bacteria 2296
79 Ga0501043_0167456 3300049579 Bacteria 1716
80 Ga0501046_0008830 3300049580 Bacteria 8753
81 Ga0501046_0019339 3300049580 Bacteria 5651
82 Ga0501047_0009000 3300049581 Bacteria 9427
83 Ga0501047_0092050 3300049581 Bacteria 2911
84 Ga0501047_0101069 3300049581 Bacteria 2763
85 Ga0501047_0278818 3300049581 Bacteria 1517
86 Ga0501070_0004987 3300049586 Bacteria 11330
87 Ga0501070_0257838 3300049586 Bacteria 1426
88 Ga0501071_0167020 3300049587 Bacteria 1647
89 Ga0501071_0236460 3300049587 Bacteria 1377
90 Ga0501079_0290501 3300049741 Bacteria 1278
91 Ga0501081_0097801 3300049743 Bacteria 2072
92 Ga0501083_0231313 3300049744 Bacteria 1204
93 Ga0501035_0086812 3300049822 Bacteria 2757
94 Ga0501044_0079444 3300049823 Bacteria 3324
95 Ga0501044_0270522 3300049823 Bacteria 1635
96 Ga0501044_0296522 3300049823 Bacteria 1547
97 Ga0501045_0029112 3300049824 Bacteria 3990
98 Ga0501045_0261235 3300049824 Bacteria 1289
99 nmdc:mga00v17_254722_c1 3300050491 Bacteria 1138
100 nmdc:mga0yw44_213634_c1 3300050492 Bacteria 1276
101 nmdc:mga06z11_41358_c1 3300050494 Bacteria 2306
102 nmdc:mga05p37_271359_c1 3300050507 Bacteria 2026
103 nmdc:mga06r32_187010_c1 3300050510 Bacteria 2058
104 nmdc:mga06r32_369663_c1 3300050510 Unclassified 1417
105 Ga0495601_0002748 3300053077 Bacteria 10001
106 Ga0495619_0015034 3300053085 Bacteria 4892
107 Ga0495619_0077484 3300053085 Bacteria 2233
108 Ga0501084_0115316 3300054114 Bacteria 2258
109 Ga0501082_0110306 3300060353 Bacteria 2382
110 Ga0530510_0361066 3300061734 Bacteria 1092

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100008718 Ga0075428_1000087188 277
2 3300046462 Ga0495651_0168190 Ga0495651_0168190_46_900 280
3 3300049577 Ga0501041_0100075 Ga0501041_0100075_803_1771 280
4 3300049741 Ga0501079_0290501 Ga0501079_0290501_259_1227 280
5 3300049743 Ga0501081_0097801 Ga0501081_0097801_1030_1998 280
6 3300049824 Ga0501045_0029112 Ga0501045_0029112_1718_2686 280
7 3300060353 Ga0501082_0110306 Ga0501082_0110306_874_1842 280
8 3300061734 Ga0530510_0361066 Ga0530510_0361066_82_1050 280
9 3300049587 Ga0501071_0167020 Ga0501071_0167020_648_1613 281
10 3300006847 Ga0075431_100227107 Ga0075431_1002271072 289
11 3300050510 nmdc:mga06r32_187010_c1 nmdc:mga06r32_187010_c1_631_1593 289
12 3300006038 Ga0075365_10225314 Ga0075365_102253141 290
13 3300050492 nmdc:mga0yw44_213634_c1 nmdc:mga0yw44_213634_c1_61_1026 290
14 3300005336 Ga0070680_100381507 Ga0070680_1003815071 297
15 3300005530 Ga0070679_100427578 Ga0070679_1004275781 297
16 3300025912 Ga0207707_10381788 Ga0207707_103817881 297
17 3300025917 Ga0207660_10191910 Ga0207660_101919101 297
18 3300049824 Ga0501045_0261235 Ga0501045_0261235_230_1198 298
19 3300049571 Ga0501034_0005272 Ga0501034_0005272_3123_4082 300
20 3300049581 Ga0501047_0278818 Ga0501047_0278818_323_1282 300
21 iso_pu_bacteria 2537561592 2537898432 300
22 3300005436 Ga0070713_100112198 Ga0070713_1001121982 303
23 3300006028 Ga0070717_10073705 Ga0070717_100737052 303
24 3300025928 Ga0207700_10018217 Ga0207700_100182172 303
25 3300006844 Ga0075428_100115955 Ga0075428_1001159552 304
26 3300037068 Ga0373925_0331745 Ga0373925_0331745_289_1212 304
27 3300003320 rootH2_10176483 rootH2_101764831 306
28 iso_pu_bacteria 8004025490 8004028889 306
29 3300048918 Ga0496115_0064538 Ga0496115_0064538_1209_2180 307
30 3300005937 Ga0081455_10053733 Ga0081455_100537333 309
31 3300050491 nmdc:mga00v17_254722_c1 nmdc:mga00v17_254722_c1_82_1047 312
32 3300054114 Ga0501084_0115316 Ga0501084_0115316_170_1120 312
33 iso_pu_bacteria 2671180531 2673167683 312
34 3300005295 Ga0065707_10142966 Ga0065707_101429662 313
35 3300049823 Ga0501044_0270522 Ga0501044_0270522_560_1510 313
36 iso_pu_bacteria 2684623219 2687238315 314
37 iso_pu_bacteria 2687453341 2688395317 314
38 iso_pu_bacteria 2920107658 2920111985 315
39 3300005563 Ga0068855_100198304 Ga0068855_1001983042 316
40 3300005985 Ga0081539_10145302 Ga0081539_101453021 316
41 3300009545 Ga0105237_10059655 Ga0105237_100596554 316
42 3300039438 Ga0436360_0411266 Ga0436360_0411266_994_1950 316
43 3300044694 Ga0466963_0076680 Ga0466963_0076680_359_1318 316
44 3300048907 Ga0496104_0224752 Ga0496104_0224752_217_1179 316
45 3300048911 Ga0496108_0107013 Ga0496108_0107013_154_1116 316
46 3300049571 Ga0501034_0092721 Ga0501034_0092721_1880_2836 316
47 3300049579 Ga0501043_0167456 Ga0501043_0167456_118_1077 316
48 3300026075 Ga0207708_10240111 Ga0207708_102401111 317
49 3300046536 Ga0495587_0065201 Ga0495587_0065201_645_1607 317
50 3300047317 Ga0495604_0057226 Ga0495604_0057226_1877_2839 317
51 3300049571 Ga0501034_0001498 Ga0501034_0001498_10728_11693 317
52 3300049571 Ga0501034_0032974 Ga0501034_0032974_1710_2672 317
53 3300049586 Ga0501070_0004987 Ga0501070_0004987_6209_7174 317
54 3300049587 Ga0501071_0236460 Ga0501071_0236460_13_978 317
55 3300049822 Ga0501035_0086812 Ga0501035_0086812_437_1408 317
56 3300049823 Ga0501044_0296522 Ga0501044_0296522_505_1476 317
57 3300053077 Ga0495601_0002748 Ga0495601_0002748_4240_5202 317
58 3300053085 Ga0495619_0015034 Ga0495619_0015034_1246_2208 317
59 3300005289 Ga0065704_10083345 Ga0065704_100833452 318
60 3300005435 Ga0070714_100134572 Ga0070714_1001345722 318
61 3300005539 Ga0068853_100075952 Ga0068853_1000759522 318
62 3300005548 Ga0070665_100000481 Ga0070665_10000048125 318
63 3300021358 Ga0213873_10030373 Ga0213873_100303732 318
64 3300026041 Ga0207639_10053612 Ga0207639_100536122 318
65 3300028379 Ga0268266_10000579 Ga0268266_1000057922 318
66 3300028379 Ga0268266_10319987 Ga0268266_103199872 318
67 3300028800 Ga0265338_10005693 Ga0265338_100056934 318
68 3300028800 Ga0265338_10182735 Ga0265338_101827352 318
69 3300031090 Ga0265760_10002606 Ga0265760_100026062 318
70 3300031241 Ga0265325_10000182 Ga0265325_1000018212 318
71 3300031249 Ga0265339_10000130 Ga0265339_1000013025 318
72 3300031250 Ga0265331_10000148 Ga0265331_1000014830 318
73 3300031595 Ga0265313_10008907 Ga0265313_100089074 318
74 3300031711 Ga0265314_10000315 Ga0265314_1000031534 318
75 3300039438 Ga0436360_0458164 Ga0436360_0458164_471_1445 318
76 3300039447 Ga0436361_0103922 Ga0436361_0103922_2281_3261 318
77 3300039447 Ga0436361_0389502 Ga0436361_0389502_941_1915 318
78 3300039453 Ga0436362_0688675 Ga0436362_0688675_2706_3686 318
79 3300047319 Ga0495674_0419884 Ga0495674_0419884_74_1045 318
80 3300049570 Ga0501033_0010724 Ga0501033_0010724_4362_5330 318
81 3300049571 Ga0501034_0040074 Ga0501034_0040074_982_1947 318
82 3300049571 Ga0501034_0075373 Ga0501034_0075373_2247_3215 318
83 3300049571 Ga0501034_0092825 Ga0501034_0092825_608_1591 318
84 3300049571 Ga0501034_0194223 Ga0501034_0194223_484_1449 318
85 3300049579 Ga0501043_0027247 Ga0501043_0027247_3395_4363 318
86 3300049579 Ga0501043_0098683 Ga0501043_0098683_91_1074 318
87 3300049580 Ga0501046_0008830 Ga0501046_0008830_5606_6574 318
88 3300049580 Ga0501046_0019339 Ga0501046_0019339_4207_5175 318
89 3300049581 Ga0501047_0009000 Ga0501047_0009000_6572_7540 318
90 3300049581 Ga0501047_0092050 Ga0501047_0092050_512_1525 318
91 3300049581 Ga0501047_0101069 Ga0501047_0101069_752_1720 318
92 3300049586 Ga0501070_0257838 Ga0501070_0257838_372_1340 318
93 3300049823 Ga0501044_0079444 Ga0501044_0079444_1642_2610 318
94 3300050494 nmdc:mga06z11_41358_c1 nmdc:mga06z11_41358_c1_765_1733 318
95 3300053085 Ga0495619_0077484 Ga0495619_0077484_758_1726 318
96 2162886011 MRS1b_contig_1498203 MRS1b_0093.00000390 319
97 3300005290 Ga0065712_10072602 Ga0065712_100726023 319
98 3300005340 Ga0070689_100205025 Ga0070689_1002050252 319
99 3300005544 Ga0070686_100163927 Ga0070686_1001639272 319
100 3300005548 Ga0070665_100163522 Ga0070665_1001635222 319
101 3300005844 Ga0068862_100275165 Ga0068862_1002751652 319
102 3300006844 Ga0075428_100012606 Ga0075428_1000126067 319
103 3300006844 Ga0075428_100022847 Ga0075428_1000228473 319
104 3300006847 Ga0075431_100249393 Ga0075431_1002493932 319
105 3300006880 Ga0075429_100184728 Ga0075429_1001847281 319
106 3300009094 Ga0111539_10412419 Ga0111539_104124192 319
107 3300009177 Ga0105248_10124373 Ga0105248_101243732 319
108 3300009553 Ga0105249_10104012 Ga0105249_101040122 319
109 3300010375 Ga0105239_10296293 Ga0105239_102962932 319
110 3300025936 Ga0207670_10105125 Ga0207670_101051252 319
111 3300025961 Ga0207712_10108218 Ga0207712_101082182 319
112 3300028379 Ga0268266_10016496 Ga0268266_100164964 319
113 3300049571 Ga0501034_0125794 Ga0501034_0125794_1039_1998 319
114 3300049744 Ga0501083_0231313 Ga0501083_0231313_10_975 319
115 3300050507 nmdc:mga05p37_271359_c1 nmdc:mga05p37_271359_c1_268_1230 319
116 3300050510 nmdc:mga06r32_369663_c1 nmdc:mga06r32_369663_c1_81_1043 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

169

296

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.862 145 247
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.8577 145 247
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8511 145 252
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8442 145 257
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8441 145 257
ID Description Score Start End Superfamily
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.844 145 254 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8365 152 276 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8187 152 276 1.20.81.30
3c1qB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8082 145 253 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7889 138 244 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A3B9MCK5-F1-model_v4 Secretion system protein 0.9426 80 315 GO:0005886
AF-A0A7Y7IPJ9-F1-model_v4 Type II secretion system protein F 0.9338 80 315 GO:0005886
AF-A0A399YHE5-F1-model_v4 Type II secretion system protein F 0.926 97 315 GO:0005886
AF-A0A498DBV1-F1-model_v4 Type II secretion system protein 0.9256 89 315 GO:0005886
AF-A0A7V2XFF3-F1-model_v4 Pilus assembly protein 0.9225 68 315 GO:0005886

Feature Viewer

pLDDT pTM Quality
77.3 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map