F088423

General Info

Members Datasets Scaffolds Average Seq Length
116 72 232 181

Family's Representative Sequence

Representative Sequence 3300021358|Ga0213873_10014506|Ga0213873_100145062
Length 201
Sequence LTRLRSLLSGGLTATAALWTPVEAAYDWVFRAAAILANVAGRTGAAVKASYRGLLGAMARHAARAGGLSGALGHFRKVTRSYWPGLFPCYDVADLPRTDNDLEQLFGSHRYHERRCSGRKVASPGLVVRGSVRVPAALATRLRGEVRGEDLAPSDLEAWQELRAGLERRQAVRAQGRRFRRDPAAYLQELEEALIKETLPP

Samples

Sample ID Description Type Environment
1 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
16 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
17 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
18 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
26 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
27 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
28 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
29 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
30 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
31 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
32 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
33 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
34 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
35 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
36 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
37 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
38 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
39 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
40 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
41 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
42 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
43 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
44 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
49 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
50 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
51 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
52 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
53 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
54 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
55 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
56 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
57 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
58 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
59 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
60 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
61 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
62 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
63 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
64 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
69 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
70 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
71 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
72 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0
Isolates 0.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.76
Rhizosphere 83.62
Stem 0
Stem Tuber 0
Unclassified 7.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213873_10014506 3300021358 Bacteria 1747
2 JGI25406J46586_10037149 3300003203 Bacteria 1759
3 rootH1_10157760 3300003323 Bacteria 3976
4 JGI25407J50210_10020174 3300003373 Bacteria 1734
5 JGI25407J50210_10020182 3300003373 Unclassified 1734
6 JGI25407J50210_10088698 3300003373 Bacteria 766
7 Ga0070676_10243266 3300005328 Bacteria 1198
8 Ga0070666_10387327 3300005335 Bacteria 1004
9 Ga0070682_100078784 3300005337 Bacteria 2126
10 Ga0070681_10355534 3300005458 Bacteria 1375
11 Ga0070693_100263164 3300005547 Bacteria 1148
12 Ga0070665_100244809 3300005548 Bacteria 1794
13 Ga0068852_100304331 3300005616 Bacteria 1544
14 Ga0081538_10034303 3300005981 Bacteria 3356
15 Ga0081538_10040308 3300005981 Bacteria 2981
16 Ga0081538_10050017 3300005981 Plasmid 2530
17 Ga0081538_10063090 3300005981 Unclassified 2107
18 Ga0081538_10069884 3300005981 Bacteria 1942
19 Ga0081539_10008700 3300005985 Bacteria 8729
20 Ga0070712_100125659 3300006175 Bacteria 1937
21 Ga0213873_10008483 3300021358 Bacteria 2100
22 Ga0213872_10054259 3300021361 Bacteria 1817
23 Ga0213872_10058953 3300021361 Bacteria 1737
24 Ga0213872_10060079 3300021361 Bacteria 1719
25 Ga0213872_10084304 3300021361 Bacteria 1425
26 Ga0213874_10019189 3300021377 Unclassified 1858
27 Ga0213871_10005766 3300021441 Bacteria 2580
28 Ga0213871_10016178 3300021441 Bacteria 1793
29 Ga0213871_10017495 3300021441 Bacteria 1742
30 Ga0213871_10116645 3300021441 Bacteria 793
31 Ga0207645_10039201 3300025907 Bacteria 3036
32 Ga0207707_10374345 3300025912 Bacteria 1225
33 Ga0207693_10088907 3300025915 Bacteria 2421
34 Ga0207678_10175001 3300026067 Bacteria 1833
35 Ga0207702_10438982 3300026078 Bacteria 1265
36 Ga0207698_10360172 3300026142 Bacteria 1377
37 Ga0268266_10156609 3300028379 Bacteria 2058
38 Ga0307405_10114583 3300031731 Bacteria 1832
39 Ga0307410_10070634 3300031852 Bacteria 2419
40 Ga0373951_0011803 3300035091 Bacteria 1964
41 Ga0373923_0225764 3300035111 Bacteria 871
42 Ga0373946_0118344 3300035171 Bacteria 1207
43 Ga0316574_0568787 3300035398 Unclassified 702
44 Ga0373937_0020903 3300036401 Bacteria 5871
45 Ga0373937_0229971 3300036401 Bacteria 1746
46 Ga0373937_0445620 3300036401 Bacteria 1229
47 Ga0395905_0315855 3300037471 Bacteria 1451
48 Ga0395905_0825423 3300037471 Bacteria 830
49 Ga0436364_1020865 3300037853 Unclassified 880
50 Ga0395901_0626592 3300038443 Bacteria 1082
51 Ga0436365_0327206 3300039437 Bacteria 972
52 Ga0436365_0872797 3300039437 Bacteria 2836
53 Ga0436360_0097872 3300039438 Bacteria 987
54 Ga0436360_0260304 3300039438 Bacteria 1765
55 Ga0436360_0269558 3300039438 Bacteria 3024
56 Ga0436360_0456916 3300039438 Bacteria 1517
57 Ga0436360_0525771 3300039438 Bacteria 854
58 Ga0436360_0610684 3300039438 Bacteria 689
59 Ga0436360_0806811 3300039438 Bacteria 3576
60 Ga0436360_1033595 3300039438 Bacteria 2286
61 Ga0436360_1186722 3300039438 Bacteria 1325
62 Ga0436360_1253564 3300039438 Bacteria 1528
63 Ga0436361_0185033 3300039447 Bacteria 1847
64 Ga0436361_0347736 3300039447 Bacteria 4549
65 Ga0436361_0445576 3300039447 Bacteria 1466
66 Ga0436361_1163352 3300039447 Bacteria 2907
67 Ga0436363_0672588 3300039450 Bacteria 584
68 Ga0436363_1489385 3300039450 Bacteria 2289
69 Ga0436362_0115184 3300039453 Bacteria 4601
70 Ga0436362_0115819 3300039453 Unclassified 1171
71 Ga0436362_0544679 3300039453 Bacteria 531
72 Ga0436362_0590806 3300039453 Bacteria 2961
73 Ga0436362_0772789 3300039453 Unclassified 1596
74 Ga0439433_0007839 3300041999 Bacteria 2309
75 Ga0439443_024261 3300042003 Unclassified 971
76 Ga0450900_005252 3300042136 Bacteria 1522
77 Ga0439460_0012126 3300042461 Bacteria 2231
78 Ga0466972_0065330 3300044658 Bacteria 1740
79 Ga0466966_0567377 3300044684 Bacteria 683
80 Ga0466961_0232314 3300044693 Bacteria 1135
81 Ga0466963_0247235 3300044694 Bacteria 1251
82 Ga0466964_0042747 3300044706 Bacteria 1837
83 Ga0466971_0044526 3300044719 Bacteria 1993
84 Ga0466957_0056435 3300044842 Bacteria 2401
85 Ga0466957_0102640 3300044842 Bacteria 1804
86 Ga0466957_0442779 3300044842 Bacteria 894
87 Ga0466959_0064547 3300045049 Bacteria 2659
88 Ga0466959_0594709 3300045049 Unclassified 744
89 Ga0451576_0128809 3300045051 Bacteria 2638
90 Ga0466958_0017382 3300045836 Bacteria 4156
91 Ga0466958_0498716 3300045836 Bacteria 790
92 Ga0466967_0242007 3300045976 Bacteria 1721
93 Ga0466967_1140828 3300045976 Bacteria 777
94 Ga0495646_0129275 3300046680 Bacteria 1423
95 Ga0496100_0088457 3300048903 Bacteria 2108
96 Ga0496100_0262602 3300048903 Bacteria 1281
97 Ga0496101_0846561 3300048904 Bacteria 721
98 Ga0496109_0458569 3300048912 Bacteria 1204
99 Ga0496109_0753010 3300048912 Bacteria 912
100 Ga0496112_0841044 3300048915 Bacteria 841
101 Ga0496115_0268324 3300048918 Bacteria 1403
102 Ga0496115_0309602 3300048918 Bacteria 1293
103 Ga0496115_0604755 3300048918 Bacteria 871
104 Ga0496117_0070369 3300048920 Bacteria 2350
105 Ga0496118_0174620 3300048921 Bacteria 1307
106 Ga0496126_0123624 3300048929 Bacteria 2241
107 Ga0501033_0403303 3300049570 Bacteria 953
108 Ga0501034_0873842 3300049571 Bacteria 788
109 Ga0501043_0167840 3300049579 Bacteria 1713
110 Ga0501046_0146454 3300049580 Bacteria 1783
111 Ga0501070_0090476 3300049586 Bacteria 2533
112 Ga0501044_0155627 3300049823 Bacteria 2265
113 Ga0501044_0317658 3300049823 Bacteria 1483
114 Ga0495601_0449345 3300053077 Bacteria 834
115 Ga0530510_0122050 3300061734 Bacteria 1913
116 2889421634 2889415604 Bacteria 8048700
117 Ga0213873_10014506
118 JGI25406J46586_10037149
119 rootH1_10157760
120 JGI25407J50210_10020174
121 JGI25407J50210_10020182
122 JGI25407J50210_10088698
123 Ga0070676_10243266
124 Ga0070666_10387327
125 Ga0070682_100078784
126 Ga0070681_10355534
127 Ga0070693_100263164
128 Ga0070665_100244809
129 Ga0068852_100304331
130 Ga0081538_10034303
131 Ga0081538_10040308
132 Ga0081538_10050017
133 Ga0081538_10063090
134 Ga0081538_10069884
135 Ga0081539_10008700
136 Ga0070712_100125659
137 Ga0213873_10008483
138 Ga0213872_10054259
139 Ga0213872_10058953
140 Ga0213872_10060079
141 Ga0213872_10084304
142 Ga0213874_10019189
143 Ga0213871_10005766
144 Ga0213871_10016178
145 Ga0213871_10017495
146 Ga0213871_10116645
147 Ga0207645_10039201
148 Ga0207707_10374345
149 Ga0207693_10088907
150 Ga0207678_10175001
151 Ga0207702_10438982
152 Ga0207698_10360172
153 Ga0268266_10156609
154 Ga0307405_10114583
155 Ga0307410_10070634
156 Ga0373951_0011803
157 Ga0373923_0225764
158 Ga0373946_0118344
159 Ga0316574_0568787
160 Ga0373937_0020903
161 Ga0373937_0229971
162 Ga0373937_0445620
163 Ga0395905_0315855
164 Ga0395905_0825423
165 Ga0436364_1020865
166 Ga0395901_0626592
167 Ga0436365_0327206
168 Ga0436365_0872797
169 Ga0436360_0097872
170 Ga0436360_0260304
171 Ga0436360_0269558
172 Ga0436360_0456916
173 Ga0436360_0525771
174 Ga0436360_0610684
175 Ga0436360_0806811
176 Ga0436360_1033595
177 Ga0436360_1186722
178 Ga0436360_1253564
179 Ga0436361_0185033
180 Ga0436361_0347736
181 Ga0436361_0445576
182 Ga0436361_1163352
183 Ga0436363_0672588
184 Ga0436363_1489385
185 Ga0436362_0115184
186 Ga0436362_0115819
187 Ga0436362_0544679
188 Ga0436362_0590806
189 Ga0436362_0772789
190 Ga0439433_0007839
191 Ga0439443_024261
192 Ga0450900_005252
193 Ga0439460_0012126
194 Ga0466972_0065330
195 Ga0466966_0567377
196 Ga0466961_0232314
197 Ga0466963_0247235
198 Ga0466964_0042747
199 Ga0466971_0044526
200 Ga0466957_0056435
201 Ga0466957_0102640
202 Ga0466957_0442779
203 Ga0466959_0064547
204 Ga0466959_0594709
205 Ga0451576_0128809
206 Ga0466958_0017382
207 Ga0466958_0498716
208 Ga0466967_0242007
209 Ga0466967_1140828
210 Ga0495646_0129275
211 Ga0496100_0088457
212 Ga0496100_0262602
213 Ga0496101_0846561
214 Ga0496109_0458569
215 Ga0496109_0753010
216 Ga0496112_0841044
217 Ga0496115_0268324
218 Ga0496115_0309602
219 Ga0496115_0604755
220 Ga0496117_0070369
221 Ga0496118_0174620
222 Ga0496126_0123624
223 Ga0501033_0403303
224 Ga0501034_0873842
225 Ga0501043_0167840
226 Ga0501046_0146454
227 Ga0501070_0090476
228 Ga0501044_0155627
229 Ga0501044_0317658
230 Ga0495601_0449345
231 Ga0530510_0122050
232 2889421634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map