F085275

General Info

Members Datasets Scaffolds Average Seq Length
115 87 230 124

Family's Representative Sequence

Representative Sequence 3300048090|Ga0495615_0153984|Ga0495615_0153984_195_641
Length 148
Sequence MLLVASPSVFAVCRLLLTVMNKINLKEKLSLISDHWNPRIIGELNGQYLKLVKFAGPFTWHHHETEDEMFLVVKGRFRMEFREANEDSAENGPGEIWLEEGEFCIVPRGVEHRPVADEEAHVLLFEPATTLNTGNVENELTRQKLGWL

Samples

Sample ID Description Type Environment
1 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
64 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
75 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
76 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
77 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
78 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
79 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
81 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
82 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
83 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
84 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
85 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
86 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
87 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 0
Rhizosphere 96.52
Stem 0
Stem Tuber 0
Unclassified 29.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495615_0153984 3300048090 Bacteria 686
2 Ga0070670_101523197 3300005331 Unclassified 614
3 Ga0068869_100002098 3300005334 Bacteria 11981
4 Ga0070692_11257674 3300005345 Unclassified 529
5 Ga0070669_100871549 3300005353 Bacteria 768
6 Ga0070674_101903366 3300005356 Unclassified 540
7 Ga0070673_100347135 3300005364 Unclassified 1316
8 Ga0070688_100571486 3300005365 Bacteria 862
9 Ga0070713_100271729 3300005436 Bacteria 1552
10 Ga0070701_10681355 3300005438 Bacteria 689
11 Ga0070705_101103158 3300005440 Unclassified 649
12 Ga0070694_100482327 3300005444 Bacteria 984
13 Ga0070708_100871307 3300005445 Unclassified 846
14 Ga0070681_10701211 3300005458 Bacteria 928
15 Ga0070681_11366297 3300005458 Bacteria 632
16 Ga0070706_101313869 3300005467 Bacteria 663
17 Ga0070707_100502487 3300005468 Bacteria 1174
18 Ga0070698_100537996 3300005471 Unclassified 1107
19 Ga0070699_100047175 3300005518 Unclassified 3727
20 Ga0070697_100000459 3300005536 Bacteria 31292
21 Ga0070697_100095628 3300005536 Unclassified 2463
22 Ga0070697_100796922 3300005536 Bacteria 836
23 Ga0070695_100008004 3300005545 Bacteria 6264
24 Ga0070695_100227859 3300005545 Bacteria 1346
25 Ga0070695_100284386 3300005545 Bacteria 1216
26 Ga0070695_101054740 3300005545 Unclassified 663
27 Ga0070696_100002368 3300005546 Bacteria 12459
28 Ga0070696_100062652 3300005546 Bacteria 2603
29 Ga0070696_100301816 3300005546 Bacteria 1227
30 Ga0070704_100123819 3300005549 Unclassified 1991
31 Ga0068859_100624779 3300005617 Bacteria 1170
32 Ga0068859_101554606 3300005617 Bacteria 730
33 Ga0068859_102108388 3300005617 Unclassified 622
34 Ga0068861_100384475 3300005719 Bacteria 1241
35 Ga0068851_10000104 3300005834 Bacteria 45630
36 Ga0068863_101028958 3300005841 Bacteria 827
37 Ga0075362_10050905 3300006177 Bacteria 1853
38 Ga0075428_100030263 3300006844 Bacteria 5988
39 Ga0075428_100131786 3300006844 Bacteria 2719
40 Ga0075428_100206289 3300006844 Bacteria 2124
41 Ga0075431_100669702 3300006847 Bacteria 1017
42 Ga0075429_100059245 3300006880 Bacteria 3335
43 Ga0097620_100624729 3300006931 Bacteria 1170
44 Ga0097620_101555162 3300006931 Bacteria 730
45 Ga0097620_102108718 3300006931 Unclassified 622
46 Ga0099794_10653660 3300007265 Unclassified 558
47 Ga0105240_10000078 3300009093 Bacteria 196646
48 Ga0111539_10002651 3300009094 Bacteria 23722
49 Ga0111539_10160943 3300009094 Bacteria 2625
50 Ga0105245_10342867 3300009098 Unclassified 1478
51 Ga0114129_10167876 3300009147 Bacteria 2994
52 Ga0105241_11892657 3300009174 Bacteria 584
53 Ga0105242_10497310 3300009176 Unclassified 1159
54 Ga0105242_11905491 3300009176 Unclassified 635
55 Ga0105242_11912475 3300009176 Unclassified 634
56 Ga0105249_10074992 3300009553 Bacteria 3132
57 Ga0105239_10000431 3300010375 Bacteria 61098
58 Ga0105239_10890630 3300010375 Bacteria 1021
59 Ga0105246_11328326 3300011119 Bacteria 668
60 Ga0157378_10084428 3300013297 Unclassified 2875
61 Ga0157378_10186482 3300013297 Bacteria 1954
62 Ga0157380_11032402 3300014326 Unclassified 857
63 Ga0157380_11518881 3300014326 Bacteria 723
64 Ga0157380_13414514 3300014326 Unclassified 508
65 Ga0157377_10626565 3300014745 Unclassified 771
66 Ga0163161_10815882 3300017792 Bacteria 785
67 Ga0207656_10000149 3300025321 Bacteria 25828
68 Ga0207654_10672404 3300025911 Bacteria 742
69 Ga0207695_10000064 3300025913 Bacteria 346010
70 Ga0207646_11428903 3300025922 Bacteria 601
71 Ga0207681_10831724 3300025923 Bacteria 772
72 Ga0207690_10635278 3300025932 Bacteria 874
73 Ga0207686_11183479 3300025934 Bacteria 625
74 Ga0207689_10013322 3300025942 Bacteria 7016
75 Ga0207651_10370230 3300025960 Unclassified 1212
76 Ga0207712_11085510 3300025961 Bacteria 712
77 Ga0207641_10992471 3300026088 Bacteria 836
78 Ga0207674_10065916 3300026116 Bacteria 3649
79 Ga0268264_12269742 3300028381 Bacteria 550
80 Ga0265338_10171214 3300028800 Unclassified 1665
81 Ga0265338_10474710 3300028800 Unclassified 883
82 Ga0265327_10023361 3300031251 Bacteria 3664
83 Ga0265316_10401604 3300031344 Bacteria 987
84 Ga0307513_10299761 3300031456 Unclassified 1374
85 Ga0307518_10422730 3300031838 Bacteria 730
86 Ga0316583_10184372 3300032133 Bacteria 725
87 Ga0373927_0224884 3300035695 Bacteria 1233
88 Ga0373925_0583270 3300037068 Bacteria 920
89 Ga0395905_0000338 3300037471 Bacteria 66984
90 Ga0436362_0134017 3300039453 Bacteria 5035
91 Ga0450896_002983 3300042133 Bacteria 2223
92 Ga0451577_0729460 3300042876 Bacteria 897
93 Ga0451577_0893288 3300042876 Bacteria 800
94 Ga0451577_1502271 3300042876 Unclassified 596
95 Ga0453683_0596208 3300044673 Unclassified 720
96 Ga0453684_0001836 3300044712 Bacteria 55520
97 Ga0453684_0367700 3300044712 Unclassified 1617
98 Ga0453684_2322096 3300044712 Bacteria 533
99 Ga0451576_0240340 3300045051 Bacteria 1892
100 Ga0495628_0396627 3300046516 Bacteria 1009
101 Ga0495598_0082952 3300046537 Unclassified 1032
102 Ga0495621_0157488 3300046539 Bacteria 896
103 Ga0495613_0806999 3300046689 Bacteria 612
104 Ga0495600_0456126 3300046809 Bacteria 790
105 Ga0501040_0855167 3300049576 Bacteria 659
106 Ga0501040_0877784 3300049576 Unclassified 649
107 Ga0501075_1075842 3300049591 Unclassified 611
108 Ga0501076_0184187 3300049592 Unclassified 1703
109 nmdc:mga05p37_287714_c1 3300050507 Bacteria 1957
110 nmdc:mga08y16_144708_c1 3300050511 Bacteria 2471
111 nmdc:mga08y16_157286_c1 3300050511 Bacteria 2362
112 nmdc:mga0rr50_1529487_c1 3300050513 Unclassified 564
113 Ga0500555_000699 3300053103 Bacteria 12665
114 Ga0501082_0873469 3300060353 Bacteria 787
115 2890806224 2890804823 Bacteria 3717572
116 Ga0495615_0153984
117 Ga0070670_101523197
118 Ga0068869_100002098
119 Ga0070692_11257674
120 Ga0070669_100871549
121 Ga0070674_101903366
122 Ga0070673_100347135
123 Ga0070688_100571486
124 Ga0070713_100271729
125 Ga0070701_10681355
126 Ga0070705_101103158
127 Ga0070694_100482327
128 Ga0070708_100871307
129 Ga0070681_10701211
130 Ga0070681_11366297
131 Ga0070706_101313869
132 Ga0070707_100502487
133 Ga0070698_100537996
134 Ga0070699_100047175
135 Ga0070697_100000459
136 Ga0070697_100095628
137 Ga0070697_100796922
138 Ga0070695_100008004
139 Ga0070695_100227859
140 Ga0070695_100284386
141 Ga0070695_101054740
142 Ga0070696_100002368
143 Ga0070696_100062652
144 Ga0070696_100301816
145 Ga0070704_100123819
146 Ga0068859_100624779
147 Ga0068859_101554606
148 Ga0068859_102108388
149 Ga0068861_100384475
150 Ga0068851_10000104
151 Ga0068863_101028958
152 Ga0075362_10050905
153 Ga0075428_100030263
154 Ga0075428_100131786
155 Ga0075428_100206289
156 Ga0075431_100669702
157 Ga0075429_100059245
158 Ga0097620_100624729
159 Ga0097620_101555162
160 Ga0097620_102108718
161 Ga0099794_10653660
162 Ga0105240_10000078
163 Ga0111539_10002651
164 Ga0111539_10160943
165 Ga0105245_10342867
166 Ga0114129_10167876
167 Ga0105241_11892657
168 Ga0105242_10497310
169 Ga0105242_11905491
170 Ga0105242_11912475
171 Ga0105249_10074992
172 Ga0105239_10000431
173 Ga0105239_10890630
174 Ga0105246_11328326
175 Ga0157378_10084428
176 Ga0157378_10186482
177 Ga0157380_11032402
178 Ga0157380_11518881
179 Ga0157380_13414514
180 Ga0157377_10626565
181 Ga0163161_10815882
182 Ga0207656_10000149
183 Ga0207654_10672404
184 Ga0207695_10000064
185 Ga0207646_11428903
186 Ga0207681_10831724
187 Ga0207690_10635278
188 Ga0207686_11183479
189 Ga0207689_10013322
190 Ga0207651_10370230
191 Ga0207712_11085510
192 Ga0207641_10992471
193 Ga0207674_10065916
194 Ga0268264_12269742
195 Ga0265338_10171214
196 Ga0265338_10474710
197 Ga0265327_10023361
198 Ga0265316_10401604
199 Ga0307513_10299761
200 Ga0307518_10422730
201 Ga0316583_10184372
202 Ga0373927_0224884
203 Ga0373925_0583270
204 Ga0395905_0000338
205 Ga0436362_0134017
206 Ga0450896_002983
207 Ga0451577_0729460
208 Ga0451577_0893288
209 Ga0451577_1502271
210 Ga0453683_0596208
211 Ga0453684_0001836
212 Ga0453684_0367700
213 Ga0453684_2322096
214 Ga0451576_0240340
215 Ga0495628_0396627
216 Ga0495598_0082952
217 Ga0495621_0157488
218 Ga0495613_0806999
219 Ga0495600_0456126
220 Ga0501040_0855167
221 Ga0501040_0877784
222 Ga0501075_1075842
223 Ga0501076_0184187
224 nmdc:mga05p37_287714_c1
225 nmdc:mga08y16_144708_c1
226 nmdc:mga08y16_157286_c1
227 nmdc:mga0rr50_1529487_c1
228 Ga0500555_000699
229 Ga0501082_0873469
230 2890806224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

51

126

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9971 4 98
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9198 4 98
2i45-assembly3.cif.gz_E crystal structure of protein nmb1881 from neisseria meningitidis 0.9192 2 99
2i45-assembly4.cif.gz_H crystal structure of protein nmb1881 from neisseria meningitidis 0.9186 2 99
2i45-assembly5.cif.gz_J crystal structure of protein nmb1881 from neisseria meningitidis 0.9117 2 99
ID Description Score Start End Superfamily
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9748 1 95 2.60.120.10
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9247 1 95 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9102 28 97 2.60.120.10
2i45I00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.905 3 99 2.60.120.10
af_P76555_101_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.904 26 98 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2E6VUN2-F1-model_v4 Cupin 1.001 3 120
AF-A0A537BVB2-F1-model_v4 Cupin domain-containing protein 1.001 5 93
AF-A0A1Z9EJJ8-F1-model_v4 Cupin 0.9997 1 120
AF-A0A0M2VRC7-F1-model_v4 deleted 0.9997 2 100
AF-A0A7V9ZUC4-F1-model_v4 Cupin domain-containing protein 0.9994 1 120

Map