F082884

General Info

Members Datasets Scaffolds Average Seq Length
115 95 230 111

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_103152536|Ga0068859_1031525362
Length 131
Sequence LPSPQIASADSFPFPLPESDGVKLLFDENLSHRLVHLLADLYPDSSHVRDVGLASADDVAVWEYAKQNALTIVSKDEDFHQRSFLYGPPPKVIWIRRGNCSTMVIERMLRDHHTDISRFLAEPEAAFLALA

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
16 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
17 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
20 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
52 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
53 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
54 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
55 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
56 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
57 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
58 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
59 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
60 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
65 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
66 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
72 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
73 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
74 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
79 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
80 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
81 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
86 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
87 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
88 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
89 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
90 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
91 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
92 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
93 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
94 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
95 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 0.87
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 37.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_103152536 3300005617 Unclassified 502
2 Ga0065712_10089060 3300005290 Bacteria 2479
3 Ga0070690_100031460 3300005330 Bacteria 3306
4 Ga0070690_100277897 3300005330 Unclassified 1193
5 Ga0070689_100027687 3300005340 Bacteria 4274
6 Ga0070687_100419626 3300005343 Unclassified 882
7 Ga0070688_100275937 3300005365 Bacteria 1206
8 Ga0070688_100558195 3300005365 Bacteria 871
9 Ga0070701_10306081 3300005438 Unclassified 979
10 Ga0068867_100502659 3300005459 Bacteria 1042
11 Ga0070679_100370655 3300005530 Bacteria 1379
12 Ga0070686_100063378 3300005544 Unclassified 2394
13 Ga0070695_100166448 3300005545 Bacteria 1552
14 Ga0070704_100216944 3300005549 Bacteria 1553
15 Ga0068859_100076875 3300005617 Bacteria 3379
16 Ga0068859_101407246 3300005617 Bacteria 769
17 Ga0068862_102535733 3300005844 Unclassified 524
18 Ga0097621_100839179 3300006237 Unclassified 853
19 Ga0075433_10290381 3300006852 Bacteria 1448
20 Ga0075434_100778488 3300006871 Bacteria 973
21 Ga0075434_101320000 3300006871 Archaea 732
22 Ga0075436_100138019 3300006914 Archaea 1713
23 Ga0097620_100076876 3300006931 Bacteria 3379
24 Ga0097620_101407317 3300006931 Bacteria 769
25 Ga0097620_103149859 3300006931 Unclassified 502
26 Ga0075435_100009050 3300007076 Bacteria 7183
27 Ga0075435_100689824 3300007076 Bacteria 887
28 Ga0099794_10098542 3300007265 Bacteria 1457
29 Ga0099794_10645213 3300007265 Unclassified 562
30 Ga0105240_10199567 3300009093 Bacteria 2345
31 Ga0111539_11645335 3300009094 Bacteria 744
32 Ga0114129_12063764 3300009147 Unclassified 688
33 Ga0105243_11686741 3300009148 Bacteria 662
34 Ga0105241_10098386 3300009174 Bacteria 2321
35 Ga0105242_11108062 3300009176 Bacteria 806
36 Ga0105249_10306070 3300009553 Bacteria 1596
37 Ga0105239_10612475 3300010375 Bacteria 1242
38 Ga0157369_10202919 3300013105 Bacteria 2081
39 Ga0157369_11547284 3300013105 Unclassified 675
40 Ga0157378_10092058 3300013297 Unclassified 2758
41 Ga0157378_10189614 3300013297 Bacteria 1938
42 Ga0157372_10066785 3300013307 Unclassified 4041
43 Ga0157372_11282740 3300013307 Bacteria 845
44 Ga0157377_10157939 3300014745 Unclassified 1407
45 Ga0213875_10007013 3300021388 Bacteria 5863
46 Ga0207654_10101253 3300025911 Bacteria 1775
47 Ga0207660_10371953 3300025917 Bacteria 1148
48 Ga0207651_11797197 3300025960 Unclassified 552
49 Ga0207712_10083229 3300025961 Bacteria 2335
50 Ga0207712_10199954 3300025961 Bacteria 1584
51 Ga0209968_1004217 3300027526 Unclassified 2160
52 Ga0209588_1143848 3300027671 Bacteria 757
53 Ga0209971_1043674 3300027682 Bacteria 1080
54 Ga0209966_1003663 3300027695 Plasmid 2592
55 Ga0209998_10065469 3300027717 Unclassified 862
56 Ga0209974_10010542 3300027876 Bacteria 3117
57 Ga0268265_12147923 3300028380 Unclassified 565
58 Ga0268264_10722580 3300028381 Bacteria 990
59 Ga0265323_10042685 3300028653 Bacteria 1640
60 Ga0265338_10320040 3300028800 Bacteria 1123
61 Ga0265338_10684988 3300028800 Unclassified 708
62 Ga0265316_10261767 3300031344 Bacteria 1268
63 Ga0307408_101799410 3300031548 Bacteria 585
64 Ga0265342_10474768 3300031712 Bacteria 640
65 Ga0316577_10058349 3300031733 Bacteria 2155
66 Ga0373934_0237460 3300035086 Bacteria 753
67 Ga0373940_0001998 3300035088 Bacteria 3860
68 Ga0373941_0097947 3300035115 Unclassified 1017
69 Ga0373953_0008560 3300035117 Bacteria 3479
70 Ga0373957_0107802 3300035120 Bacteria 1120
71 Ga0373961_0000225 3300035241 Bacteria 26568
72 Ga0373962_0041434 3300035242 Unclassified 1298
73 Ga0373931_0470639 3300035691 Unclassified 806
74 Ga0373933_0202999 3300035724 Bacteria 1269
75 Ga0373937_0234026 3300036401 Unclassified 1730
76 Ga0373937_0259927 3300036401 Bacteria 1637
77 Ga0395905_0273052 3300037471 Bacteria 1577
78 Ga0436364_0634211 3300037853 Bacteria 13119
79 Ga0436362_0234114 3300039453 Bacteria 1711
80 Ga0451807_1367243 3300041486 Unclassified 854
81 Ga0439434_0239870 3300042435 Unclassified 618
82 Ga0453683_0058729 3300044673 Bacteria 2406
83 Ga0453684_2461730 3300044712 Unclassified 514
84 Ga0451576_0086207 3300045051 Unclassified 3266
85 Ga0495608_0376713 3300046511 Bacteria 870
86 Ga0495586_0317694 3300046535 Bacteria 893
87 Ga0495667_0022082 3300046559 Unclassified 4289
88 Ga0495667_0672516 3300046559 Unclassified 642
89 Ga0495657_0024076 3300046675 Unclassified 4341
90 Ga0495658_0197777 3300046683 Bacteria 1252
91 Ga0495613_0095907 3300046689 Bacteria 2145
92 Ga0495624_0957609 3300046690 Unclassified 503
93 Ga0495600_0717640 3300046809 Unclassified 600
94 Ga0495604_0316024 3300047317 Unclassified 1045
95 Ga0495636_0228546 3300047318 Unclassified 855
96 Ga0495684_0464175 3300047471 Unclassified 877
97 Ga0501040_0085086 3300049576 Viruses 2195
98 Ga0501048_0246906 3300049582 Unclassified 1267
99 Ga0501071_0355050 3300049587 Unclassified 1116
100 Ga0501075_0105948 3300049591 Viruses 2137
101 nmdc:mga06z11_548336_c1 3300050494 Unclassified 702
102 nmdc:mga05p37_792557_c1 3300050507 Bacteria 1038
103 nmdc:mga08y16_1710009_c1 3300050511 Bacteria 584
104 nmdc:mga0n895_415736_c1 3300050512 Bacteria 1360
105 nmdc:mga0n895_999195_c1 3300050512 Bacteria 818
106 nmdc:mga0rr50_672820_c1 3300050513 Bacteria 883
107 nmdc:mga0rr50_86479_c1 3300050513 Unclassified 2432
108 nmdc:mga0rr50_918444_c1 3300050513 Unclassified 746
109 nmdc:mga08x19_28644_c1 3300050514 Bacteria 3490
110 nmdc:mga0a205_363484_c1 3300050515 Bacteria 1314
111 Ga0500627_0320225 3300053158 Unclassified 674
112 Ga0501084_0574176 3300054114 Archaea 953
113 Ga0590075_055812 3300059424 Bacteria 1015
114 Ga0530510_0154802 3300061734 Unclassified 1694
115 Ga0530510_0628425 3300061734 Unclassified 817
116 Ga0068859_103152536
117 Ga0065712_10089060
118 Ga0070690_100031460
119 Ga0070690_100277897
120 Ga0070689_100027687
121 Ga0070687_100419626
122 Ga0070688_100275937
123 Ga0070688_100558195
124 Ga0070701_10306081
125 Ga0068867_100502659
126 Ga0070679_100370655
127 Ga0070686_100063378
128 Ga0070695_100166448
129 Ga0070704_100216944
130 Ga0068859_100076875
131 Ga0068859_101407246
132 Ga0068862_102535733
133 Ga0097621_100839179
134 Ga0075433_10290381
135 Ga0075434_100778488
136 Ga0075434_101320000
137 Ga0075436_100138019
138 Ga0097620_100076876
139 Ga0097620_101407317
140 Ga0097620_103149859
141 Ga0075435_100009050
142 Ga0075435_100689824
143 Ga0099794_10098542
144 Ga0099794_10645213
145 Ga0105240_10199567
146 Ga0111539_11645335
147 Ga0114129_12063764
148 Ga0105243_11686741
149 Ga0105241_10098386
150 Ga0105242_11108062
151 Ga0105249_10306070
152 Ga0105239_10612475
153 Ga0157369_10202919
154 Ga0157369_11547284
155 Ga0157378_10092058
156 Ga0157378_10189614
157 Ga0157372_10066785
158 Ga0157372_11282740
159 Ga0157377_10157939
160 Ga0213875_10007013
161 Ga0207654_10101253
162 Ga0207660_10371953
163 Ga0207651_11797197
164 Ga0207712_10083229
165 Ga0207712_10199954
166 Ga0209968_1004217
167 Ga0209588_1143848
168 Ga0209971_1043674
169 Ga0209966_1003663
170 Ga0209998_10065469
171 Ga0209974_10010542
172 Ga0268265_12147923
173 Ga0268264_10722580
174 Ga0265323_10042685
175 Ga0265338_10320040
176 Ga0265338_10684988
177 Ga0265316_10261767
178 Ga0307408_101799410
179 Ga0265342_10474768
180 Ga0316577_10058349
181 Ga0373934_0237460
182 Ga0373940_0001998
183 Ga0373941_0097947
184 Ga0373953_0008560
185 Ga0373957_0107802
186 Ga0373961_0000225
187 Ga0373962_0041434
188 Ga0373931_0470639
189 Ga0373933_0202999
190 Ga0373937_0234026
191 Ga0373937_0259927
192 Ga0395905_0273052
193 Ga0436364_0634211
194 Ga0436362_0234114
195 Ga0451807_1367243
196 Ga0439434_0239870
197 Ga0453683_0058729
198 Ga0453684_2461730
199 Ga0451576_0086207
200 Ga0495608_0376713
201 Ga0495586_0317694
202 Ga0495667_0022082
203 Ga0495667_0672516
204 Ga0495657_0024076
205 Ga0495658_0197777
206 Ga0495613_0095907
207 Ga0495624_0957609
208 Ga0495600_0717640
209 Ga0495604_0316024
210 Ga0495636_0228546
211 Ga0495684_0464175
212 Ga0501040_0085086
213 Ga0501048_0246906
214 Ga0501071_0355050
215 Ga0501075_0105948
216 nmdc:mga06z11_548336_c1
217 nmdc:mga05p37_792557_c1
218 nmdc:mga08y16_1710009_c1
219 nmdc:mga0n895_415736_c1
220 nmdc:mga0n895_999195_c1
221 nmdc:mga0rr50_672820_c1
222 nmdc:mga0rr50_86479_c1
223 nmdc:mga0rr50_918444_c1
224 nmdc:mga08x19_28644_c1
225 nmdc:mga0a205_363484_c1
226 Ga0500627_0320225
227 Ga0501084_0574176
228 Ga0590075_055812
229 Ga0530510_0154802
230 Ga0530510_0628425

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18480

DUF5615

Domain of unknown function (DUF5615)

22

131

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5sv2-assembly1.cif.gz_A-2 toxin vapc21 from mycobacterium tuberculosis 0.6127 1 73
3i8o-assembly1.cif.gz_A a domain of a functionally unknown protein from methanocaldococcus jannaschii dsm 2661. 0.5869 12 80
5ecw-assembly1.cif.gz_A structure of the shigella flexneri vapc mutant d7a 0.538 12 71
3q15-assembly2.cif.gz_D-3 crystal structure of raph complexed with spo0f 0.5096 1 91
5gvw-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.5028 3 97
ID Description Score Start End Superfamily
5sv2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.6127 1 73 3.40.50.1010
3h87A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.5964 12 67 3.40.50.1010
3aw9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.5543 1 108 3.40.50.720
1zitA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.5468 2 97 3.40.50.2300
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.5422 12 73 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A800MAT1-F1-model_v4 DUF5615 domain-containing protein 0.9899 49 109
AF-A0A849U649-F1-model_v4 DUF5615 family PIN-like protein 0.9898 1 110
AF-A0A7V2H766-F1-model_v4 DUF5615 domain-containing protein 0.9897 1 110
AF-L8M709-F1-model_v4 DUF5615 domain-containing protein 0.9897 1 110
AF-A0A399X2X2-F1-model_v4 DUF5615 domain-containing protein 0.989 37 110

Map