F081194

General Info

Members Datasets Scaffolds Average Seq Length
114 79 76 397

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919391150|2919395771
Length 428
Sequence SGPPRSSTPPVPPSPGNRAGAAGTSGLASNGRRRYNVLVVGGGNAGISLAARLRRYGVRDVAVVEPSGRHLFQPLFSHIGGGTAEAAEAVRPQESVMPKGVTWIPDSAVDIKPETNTVELASGIRLSYGHVVVCPGLQLDWHKVPGLAEAMESPHASSNYVYELAPKTWALLSGLRSGTAVFTMPSGPVKCGGASQKPMYLACDYWRQQGVLSNIRVVMVVPTPTVYGVAGVDEELNRKIAEYGIELRCNSEVTAVDADARALQIRNSASGSSESLAYDVLHAVPPQSAPDWLKNTELPVPGDDGGFVEVDPETLRHPRYPNVWSLGDAAGTKNSKAGAALRKQATVLAKNIKAVTKGEEPKTKYNGYSACPFTVSRSTVVFAEFDDEYKPMPTIPKVGVAKERHSTWILERDLFPGIYWNLILKGRA

Samples

Sample ID Description Type Environment
1 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
2 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
3 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
4 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
5 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
6 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
7 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
8 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
9 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
10 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
11 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
12 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
13 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
14 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
15 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
16 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
17 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
18 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
19 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
20 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
21 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
22 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
23 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
24 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
25 2920879853 Kocuria salina CV6 Isolate Unclassified
26 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
27 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
28 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
29 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
30 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
31 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
32 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
33 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
34 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
35 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
36 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
37 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
49 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
64 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
65 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
68 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
69 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
76 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
77 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
78 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
79 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 65.79
Metatranscriptomes 0.88
Isolates 33.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 1.75
Rhizosphere 77.19
Stem 0
Stem Tuber 0
Unclassified 20.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000536 3300000549 Bacteria 6235
2 Ga0070683_100146200 3300005329 Bacteria 2240
3 Ga0070710_10110837 3300005437 Bacteria 1648
4 Ga0070706_100016934 3300005467 Bacteria 6733
5 Ga0070665_100396996 3300005548 Bacteria 1387
6 Ga0081455_10099946 3300005937 Bacteria 2332
7 Ga0070717_10101866 3300006028 Bacteria 2439
8 Ga0075364_10108361 3300006051 Bacteria 1853
9 Ga0105247_10191685 3300009101 Bacteria 1369
10 Ga0207692_10091572 3300025898 Bacteria 1650
11 Ga0207684_10039797 3300025910 Bacteria 3985
12 Ga0307408_100002598 3300031548 Bacteria 12579
13 Ga0307408_100062198 3300031548 Bacteria 2727
14 Ga0307408_100085786 3300031548 Bacteria 2365
15 Ga0307408_100089157 3300031548 Bacteria 2324
16 Ga0316576_10082651 3300031727 Bacteria 2385
17 Ga0307405_10001800 3300031731 Bacteria 9173
18 Ga0307405_10028711 3300031731 Bacteria 3243
19 Ga0307405_10037749 3300031731 Bacteria 2906
20 Ga0307405_10062605 3300031731 Bacteria 2357
21 Ga0307405_10104890 3300031731 Bacteria 1903
22 Ga0307413_10030020 3300031824 Bacteria 3049
23 Ga0307413_10062396 3300031824 Bacteria 2305
24 Ga0307410_10044234 3300031852 Bacteria 2956
25 Ga0307410_10052829 3300031852 Bacteria 2747
26 Ga0307410_10078918 3300031852 Bacteria 2305
27 Ga0307410_10091088 3300031852 Bacteria 2164
28 Ga0307410_10116146 3300031852 Bacteria 1944
29 Ga0307410_10124727 3300031852 Bacteria 1883
30 Ga0307406_10098646 3300031901 Bacteria 1984
31 Ga0307407_10124412 3300031903 Bacteria 1640
32 Ga0307412_10002319 3300031911 Bacteria 10541
33 Ga0307412_10035919 3300031911 Bacteria 3170
34 Ga0307412_10080287 3300031911 Bacteria 2253
35 Ga0307412_10130168 3300031911 Bacteria 1826
36 Ga0307409_100172923 3300031995 Bacteria 1903
37 Ga0307409_100185200 3300031995 Bacteria 1847
38 Ga0307416_100025579 3300032002 Bacteria 4330
39 Ga0307416_100049589 3300032002 Bacteria 3339
40 Ga0307416_100058795 3300032002 Bacteria 3120
41 Ga0307416_100090022 3300032002 Bacteria 2629
42 Ga0307416_100219033 3300032002 Bacteria 1823
43 Ga0307414_10118745 3300032004 Bacteria 2029
44 Ga0307415_100031857 3300032126 Bacteria 3403
45 Ga0316588_1013046 3300033528 Bacteria 1797
46 Ga0395900_0101670 3300037418 Bacteria 2952
47 Ga0395900_0161496 3300037418 Bacteria 2285
48 Ga0395898_0055020 3300037466 Bacteria 3882
49 Ga0400483_003819 3300039062 Bacteria 1813
50 Ga0400483_067469 3300039062 Bacteria 21794
51 Ga0400483_118487 3300039062 Bacteria 3967
52 Ga0400483_256220 3300039062 Bacteria 7405
53 Ga0439449_0062657 3300042007 Bacteria 1372
54 Ga0439462_0033744 3300042015 Bacteria 1358
55 Ga0466970_0052813 3300044765 Bacteria 2170
56 Ga0496102_0191341 3300048905 Bacteria 1928
57 Ga0496106_0249043 3300048909 Bacteria 1420
58 Ga0501032_0002928 3300049569 Bacteria 13276
59 Ga0501032_0009380 3300049569 Bacteria 7088
60 Ga0501034_0001356 3300049571 Bacteria 33085
61 Ga0501036_0256355 3300049572 Bacteria 1465
62 Ga0501037_0000220 3300049573 Bacteria 49798
63 Ga0501037_0003942 3300049573 Bacteria 10764
64 Ga0501037_0020717 3300049573 Bacteria 4855
65 Ga0501038_0000980 3300049574 Bacteria 25615
66 Ga0501038_0107843 3300049574 Bacteria 2310
67 Ga0501038_0152456 3300049574 Bacteria 1883
68 Ga0501039_0003973 3300049575 Bacteria 11111
69 Ga0501039_0005823 3300049575 Bacteria 9334
70 Ga0501039_0128002 3300049575 Bacteria 1992
71 Ga0501067_0011875 3300049583 Bacteria 4828
72 Ga0501067_0095216 3300049583 Bacteria 1653
73 Ga0501069_0139941 3300049585 Bacteria 1388
74 Ga0501070_0002587 3300049586 Bacteria 15818
75 Ga0501044_0007721 3300049823 Bacteria 11828
76 Ga0501044_0057912 3300049823 Bacteria 3975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10104890 Ga0307405_101048902 337
2 3300006051 Ga0075364_10108361 Ga0075364_101083611 357
3 3300042007 Ga0439449_0062657 Ga0439449_0062657_22_1119 365
4 iso_pu_bacteria 2919391150 2919395802 367
5 3300032002 Ga0307416_100049589 Ga0307416_1000495893 371
6 3300039062 Ga0400483_067469 Ga0400483_067469_11227_12447 378
7 3300005329 Ga0070683_100146200 Ga0070683_1001462002 379
8 3300031548 Ga0307408_100062198 Ga0307408_1000621983 379
9 3300049583 Ga0501067_0011875 Ga0501067_0011875_2003_3178 379
10 3300049585 Ga0501069_0139941 Ga0501069_0139941_76_1251 379
11 iso_pu_bacteria 2857479173 2857480957 379
12 iso_pu_bacteria 2857632687 2857633275 379
13 iso_pu_bacteria 2870801768 2870804221 379
14 iso_pu_bacteria 2870804320 2870806062 379
15 3300031995 Ga0307409_100185200 Ga0307409_1001852001 382
16 3300037466 Ga0395898_0055020 Ga0395898_0055020_133_1317 382
17 iso_pu_bacteria 2920879853 2920880608 383
18 3300005437 Ga0070710_10110837 Ga0070710_101108372 385
19 3300005467 Ga0070706_100016934 Ga0070706_1000169342 385
20 3300005937 Ga0081455_10099946 Ga0081455_100999461 385
21 3300006028 Ga0070717_10101866 Ga0070717_101018662 385
22 3300009101 Ga0105247_10191685 Ga0105247_101916851 385
23 3300025898 Ga0207692_10091572 Ga0207692_100915722 385
24 3300025910 Ga0207684_10039797 Ga0207684_100397973 385
25 3300031548 Ga0307408_100002598 Ga0307408_1000025987 385
26 3300031727 Ga0316576_10082651 Ga0316576_100826512 385
27 3300031731 Ga0307405_10001800 Ga0307405_100018004 385
28 3300031824 Ga0307413_10030020 Ga0307413_100300203 385
29 3300031852 Ga0307410_10052829 Ga0307410_100528293 385
30 3300031852 Ga0307410_10091088 Ga0307410_100910883 385
31 3300031852 Ga0307410_10116146 Ga0307410_101161462 385
32 3300031901 Ga0307406_10098646 Ga0307406_100986462 385
33 3300031911 Ga0307412_10002319 Ga0307412_100023195 385
34 3300031911 Ga0307412_10130168 Ga0307412_101301682 385
35 3300031995 Ga0307409_100172923 Ga0307409_1001729232 385
36 3300032002 Ga0307416_100058795 Ga0307416_1000587953 385
37 3300032002 Ga0307416_100219033 Ga0307416_1002190332 385
38 3300033528 Ga0316588_1013046 Ga0316588_10130461 385
39 3300037418 Ga0395900_0101670 Ga0395900_0101670_909_2087 385
40 3300037418 Ga0395900_0161496 Ga0395900_0161496_251_1426 385
41 3300039062 Ga0400483_003819 Ga0400483_003819_304_1503 385
42 3300039062 Ga0400483_118487 Ga0400483_118487_1967_3169 385
43 3300039062 Ga0400483_256220 Ga0400483_256220_1735_2937 385
44 3300049569 Ga0501032_0002928 Ga0501032_0002928_6134_7342 385
45 3300049569 Ga0501032_0009380 Ga0501032_0009380_894_2090 385
46 3300049571 Ga0501034_0001356 Ga0501034_0001356_17269_18477 385
47 3300049572 Ga0501036_0256355 Ga0501036_0256355_218_1426 385
48 3300049573 Ga0501037_0000220 Ga0501037_0000220_5807_7015 385
49 3300049573 Ga0501037_0003942 Ga0501037_0003942_527_1723 385
50 3300049573 Ga0501037_0020717 Ga0501037_0020717_2920_4116 385
51 3300049574 Ga0501038_0000980 Ga0501038_0000980_9128_10336 385
52 3300049574 Ga0501038_0152456 Ga0501038_0152456_640_1836 385
53 3300049575 Ga0501039_0003973 Ga0501039_0003973_4800_5996 385
54 3300049575 Ga0501039_0005823 Ga0501039_0005823_1010_2218 385
55 3300049575 Ga0501039_0128002 Ga0501039_0128002_85_1281 385
56 3300049583 Ga0501067_0095216 Ga0501067_0095216_75_1283 385
57 3300049586 Ga0501070_0002587 Ga0501070_0002587_14581_15789 385
58 3300049823 Ga0501044_0007721 Ga0501044_0007721_6732_7940 385
59 3300049823 Ga0501044_0057912 Ga0501044_0057912_575_1771 385
60 iso_pu_bacteria 2515154088 2515494425 385
61 iso_pu_bacteria 2515154137 2515756654 385
62 iso_pu_bacteria 2515154203 2516088985 385
63 iso_pu_bacteria 2523231044 2523387716 385
64 iso_pu_bacteria 2690315906 2691515156 385
65 iso_pu_bacteria 2775506735 2775655612 385
66 iso_pu_bacteria 2808606357 2808828347 385
67 iso_pu_bacteria 2808606360 2808849588 385
68 iso_pu_bacteria 2808606370 2808892566 385
69 iso_pu_bacteria 2808606371 2808895339 385
70 iso_pu_bacteria 2811994871 2812319934 385
71 iso_pu_bacteria 2857740372 2857742518 385
72 iso_pu_bacteria 2904497146 2904498375 385
73 iso_pu_bacteria 2904776348 2904779288 385
74 iso_pu_bacteria 2905926851 2905928566 385
75 iso_pu_bacteria 2910809715 2910811500 385
76 iso_pu_bacteria 2919034639 2919035084 385
77 iso_pu_bacteria 2919443155 2919443901 385
78 iso_pu_bacteria 2919538618 2919540555 385
79 iso_pu_bacteria 2932426870 2932428399 385
80 iso_pu_bacteria 2933418574 2933421023 385
81 iso_pu_bacteria 2939598168 2939599197 385
82 iso_pu_bacteria 2939674588 2939675139 385
83 iso_pu_bacteria 2945916053 2945917685 385
84 iso_pu_bacteria 2945920336 2945922025 385
85 iso_pu_bacteria 2946037020 2946037725 385
86 iso_pu_bacteria 2946059875 2946061502 385
87 iso_pu_bacteria 2953998280 2953998988 385
88 iso_pu_bacteria 2974302888 2974305747 385
89 iso_pu_bacteria 8003856774 8003862321 385
90 3300005548 Ga0070665_100396996 Ga0070665_1003969961 387
91 3300032002 Ga0307416_100025579 Ga0307416_1000255794 387
92 3300042015 Ga0439462_0033744 Ga0439462_0033744_68_1270 387
93 3300044765 Ga0466970_0052813 Ga0466970_0052813_856_2067 387
94 3300048905 Ga0496102_0191341 Ga0496102_0191341_123_1376 387
95 3300048909 Ga0496106_0249043 Ga0496106_0249043_34_1287 387
96 3300031548 Ga0307408_100085786 Ga0307408_1000857862 389
97 3300031731 Ga0307405_10037749 Ga0307405_100377492 389
98 3300031824 Ga0307413_10062396 Ga0307413_100623962 389
99 3300031852 Ga0307410_10124727 Ga0307410_101247271 389
100 3300031903 Ga0307407_10124412 Ga0307407_101244122 389
101 3300031911 Ga0307412_10035919 Ga0307412_100359193 389
102 3300032004 Ga0307414_10118745 Ga0307414_101187452 389
103 3300032126 Ga0307415_100031857 Ga0307415_1000318573 389
104 iso_pu_bacteria 2946003308 2946003485 392
105 iso_pu_bacteria 2919391150 2919395771 394
106 3300031548 Ga0307408_100089157 Ga0307408_1000891572 397
107 3300000549 LJQas_1000536 LJQas_10005362 398
108 3300031731 Ga0307405_10028711 Ga0307405_100287113 398
109 3300031731 Ga0307405_10062605 Ga0307405_100626052 398
110 3300031852 Ga0307410_10044234 Ga0307410_100442343 398
111 3300031852 Ga0307410_10078918 Ga0307410_100789182 398
112 3300031911 Ga0307412_10080287 Ga0307412_100802871 398
113 3300032002 Ga0307416_100090022 Ga0307416_1000900222 398
114 3300049574 Ga0501038_0107843 Ga0501038_0107843_213_1454 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

35

352

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mp5-assembly1.cif.gz_A crystal structure of native human sulfide:quinone oxidoreductase 0.9619 13 397
8dhk-assembly1.cif.gz_B crystal structure of human sulfide quinone oxidoreductase k207e 0.9596 14 397
6oib-assembly1.cif.gz_A crystal structure of human sulfide quinone oxidoreductase in complex with coenzyme q 0.9587 14 397
6oi6-assembly1.cif.gz_B crystal structure of human sulfide quinone oxidoreductase in complex with coenzyme q (sulfide soaked) 0.9538 14 396
6mp5-assembly1.cif.gz_A crystal structure of native human sulfide:quinone oxidoreductase 0.9218 13 397
ID Description Score Start End Superfamily
af_Q2G1R5_7_393_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9671 14 393 3.50.50.100
af_Q54DK1_45_427_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9631 13 389 3.50.50.100
af_B0BMT9_46_428_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9586 14 391 3.50.50.100
af_O94284_27_435_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9531 14 389 1.25.10.10
af_O62133_10_209_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9453 19 191 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7X6HAM3-F1-model_v4 deleted 0.9889 24 215
AF-A0A142NRX1-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9881 11 398 GO:0070221
GO:0070224
GO:0071949
AF-A0A1H2B7Q9-F1-model_v4 Sulfide:quinone oxidoreductase 0.9848 9 398 GO:0070221
GO:0070224
GO:0071949
AF-K0JVG3-F1-model_v4 Sulfide-quinone reductase 0.9847 14 398 GO:0016020
GO:0070221
GO:0070224
GO:0071949
AF-A0A7Y9QWP1-F1-model_v4 deleted 0.9841 13 398

Feature Viewer

pLDDT pTM Quality
91.84 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map