F079661

General Info

Members Datasets Scaffolds Average Seq Length
114 83 228 230

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0039277|Ga0373956_0039277_637_1383
Length 248
Sequence VFRTKIFQVPVFRLDDRLVFPPPALAEDGLLAVGGDLRPERLLVAYASGIFPWYDEGQPILWHSPDPRMVLDAGKLHVPASLRKAIRRRPYRLTLDTAFDEVIAGCAAVRRPEGPGTWITPEMIEAYSELHRRGFAHSAEAWEGEALAGGLYGVSLGGAYFGESMFARRPDASKIAFAALVGQLGRWGITLVDCQVHTEHLERFGAEEWPRSRYLEALGRALERKTRRGVWRFDAKAGGAPTESLRSS

Samples

Sample ID Description Type Environment
1 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
20 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
36 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
38 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
39 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
40 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
41 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
42 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
43 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
44 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
45 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
46 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
47 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
48 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
49 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
50 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
51 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
52 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
53 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
54 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
55 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
61 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
62 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
63 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
64 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
65 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
71 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
72 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
73 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
74 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
75 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
76 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
77 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
78 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
79 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
80 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
81 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
82 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
83 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.37
Metatranscriptomes 0
Isolates 2.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.88
Rhizosphere 88.6
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373956_0039277 3300035119 Bacteria 2097
2 Ga0065714_10124925 3300005288 Bacteria 1284
3 Ga0065714_10136681 3300005288 Bacteria 1203
4 Ga0070666_10004240 3300005335 Bacteria 8711
5 Ga0070669_100890410 3300005353 Bacteria 760
6 Ga0070694_100207392 3300005444 Bacteria 1464
7 Ga0070708_100001115 3300005445 Bacteria 20525
8 Ga0070708_100036898 3300005445 Bacteria 4263
9 Ga0070708_100510905 3300005445 Bacteria 1133
10 Ga0070706_100000048 3300005467 Bacteria 142843
11 Ga0070706_100007517 3300005467 Bacteria 10212
12 Ga0070706_100179538 3300005467 Bacteria 1976
13 Ga0070707_100003317 3300005468 Bacteria 15200
14 Ga0070707_100006887 3300005468 Bacteria 10525
15 Ga0070699_100000868 3300005518 Bacteria 28150
16 Ga0070699_100011030 3300005518 Bacteria 7816
17 Ga0070699_100273854 3300005518 Bacteria 1511
18 Ga0070697_100004839 3300005536 Bacteria 10325
19 Ga0070697_100097839 3300005536 Bacteria 2435
20 Ga0070695_100038570 3300005545 Unclassified 3016
21 Ga0070704_100014491 3300005549 Bacteria 4927
22 Ga0068860_100015320 3300005843 Bacteria 7489
23 Ga0070717_10948699 3300006028 Bacteria 783
24 Ga0097621_100440996 3300006237 Bacteria 1172
25 Ga0075430_100043028 3300006846 Bacteria 3818
26 Ga0075433_10309931 3300006852 Bacteria 1397
27 Ga0075433_10313303 3300006852 Bacteria 1389
28 Ga0075434_100136618 3300006871 Bacteria 2471
29 Ga0075435_100101168 3300007076 Bacteria 2388
30 Ga0099794_10000003 3300007265 Bacteria 139452
31 Ga0111539_10000663 3300009094 Bacteria 44465
32 Ga0105245_10214506 3300009098 Unclassified 1854
33 Ga0114129_10048746 3300009147 Bacteria 5952
34 Ga0114129_10378218 3300009147 Bacteria 1871
35 Ga0114129_10404843 3300009147 Bacteria 1797
36 Ga0157371_10001432 3300013102 Bacteria 24789
37 Ga0157370_10021924 3300013104 Bacteria 6362
38 Ga0157375_10011761 3300013308 Bacteria 7738
39 Ga0163163_10254220 3300014325 Bacteria 1808
40 Ga0157380_10023665 3300014326 Bacteria 4636
41 Ga0157379_10024033 3300014968 Bacteria 5408
42 Ga0207680_10097902 3300025903 Bacteria 1879
43 Ga0207684_10000121 3300025910 Bacteria 143066
44 Ga0207684_10001931 3300025910 Bacteria 21489
45 Ga0207684_10011692 3300025910 Bacteria 7658
46 Ga0207646_10001192 3300025922 Bacteria 32725
47 Ga0207646_10020595 3300025922 Bacteria 6109
48 Ga0207658_10258890 3300025986 Bacteria 1482
49 Ga0209588_1000001 3300027671 Bacteria 705877
50 Ga0207428_10030129 3300027907 Bacteria 4488
51 Ga0268264_10028262 3300028381 Bacteria 4586
52 Ga0265316_10003119 3300031344 Bacteria 16896
53 Ga0307508_10019530 3300031616 Bacteria 6160
54 Ga0307405_10483498 3300031731 Bacteria 989
55 Ga0316577_10035754 3300031733 Bacteria 2777
56 Ga0373934_0130882 3300035086 Bacteria 1023
57 Ga0373949_0017711 3300035090 Bacteria 1609
58 Ga0373923_0037421 3300035111 Bacteria 1985
59 Ga0373933_0013102 3300035724 Bacteria 4592
60 Ga0373937_0023572 3300036401 Bacteria 5543
61 Ga0373937_0057365 3300036401 Bacteria 3577
62 Ga0316584_0118004 3300036712 Bacteria 1984
63 Ga0316584_0438422 3300036712 Bacteria 926
64 Ga0400490_26487 3300038726 Bacteria 3837
65 Ga0400485_12879 3300038735 Bacteria 3743
66 Ga0400488_29379 3300038741 Bacteria 2267
67 Ga0400486_21861 3300038742 Bacteria 2268
68 Ga0400483_134088 3300039062 Bacteria 2684
69 Ga0400483_199224 3300039062 Bacteria 2555
70 Ga0400489_22168 3300039093 Bacteria 11552
71 Ga0400487_38608 3300039110 Bacteria 8916
72 Ga0436363_1479011 3300039450 Bacteria 5101
73 Ga0450901_004862 3300042533 Bacteria 1384
74 Ga0451577_0034144 3300042876 Bacteria 4587
75 Ga0451577_0069350 3300042876 Bacteria 3144
76 Ga0453683_0003045 3300044673 Bacteria 12549
77 Ga0453684_0004151 3300044712 Bacteria 31346
78 Ga0453684_0068714 3300044712 Bacteria 4497
79 Ga0453684_0122636 3300044712 Bacteria 3135
80 Ga0451576_0001251 3300045051 Bacteria 44672
81 Ga0451576_0055070 3300045051 Bacteria 4162
82 Ga0451576_0120993 3300045051 Bacteria 2725
83 Ga0451576_0239055 3300045051 Bacteria 1897
84 Ga0495580_0419846 3300046472 Bacteria 900
85 Ga0495630_0704156 3300046517 Bacteria 773
86 Ga0495663_0001585 3300046525 Bacteria 7117
87 Ga0495633_0007811 3300046558 Bacteria 6110
88 Ga0495658_0014559 3300046683 Bacteria 4022
89 Ga0496114_0000835 3300048917 Bacteria 23048
90 Ga0501031_0054706 3300049568 Bacteria 2600
91 Ga0501036_0277259 3300049572 Bacteria 1403
92 Ga0501040_0071330 3300049576 Bacteria 2398
93 Ga0501040_0073741 3300049576 Bacteria 2359
94 Ga0501041_0144239 3300049577 Bacteria 1485
95 Ga0501041_0187552 3300049577 Bacteria 1295
96 Ga0501074_0116928 3300049590 Bacteria 1908
97 Ga0501075_0099389 3300049591 Bacteria 2209
98 Ga0501075_0230421 3300049591 Bacteria 1413
99 Ga0501081_0089422 3300049743 Bacteria 2164
100 Ga0501035_0199263 3300049822 Bacteria 1718
101 nmdc:mga05p37_166890_c1 3300050507 Bacteria 2686
102 nmdc:mga05p37_330719_c1 3300050507 Bacteria 1800
103 nmdc:mga05p37_917992_c1 3300050507 Bacteria 942
104 nmdc:mga0qj67_27312_c1 3300050509 Bacteria 4422
105 nmdc:mga08y16_145118_c1 3300050511 Bacteria 2467
106 nmdc:mga08y16_2682_c1 3300050511 Bacteria 18282
107 nmdc:mga0n895_339985_c1 3300050512 Bacteria 1520
108 nmdc:mga0rr50_149279_c1 3300050513 Bacteria 1887
109 nmdc:mga0a205_117348_c1 3300050515 Bacteria 1441
110 nmdc:mga0a205_19277_c1 3300050515 Bacteria 6428
111 Ga0530510_0214033 3300061734 Bacteria 1432
112 2842757876 2842757796 Bacteria 3981385
113 2919500366 2919497567 Bacteria 4408621
114 8055695526 8055693939 Bacteria 4772047
115 Ga0373956_0039277
116 Ga0065714_10124925
117 Ga0065714_10136681
118 Ga0070666_10004240
119 Ga0070669_100890410
120 Ga0070694_100207392
121 Ga0070708_100001115
122 Ga0070708_100036898
123 Ga0070708_100510905
124 Ga0070706_100000048
125 Ga0070706_100007517
126 Ga0070706_100179538
127 Ga0070707_100003317
128 Ga0070707_100006887
129 Ga0070699_100000868
130 Ga0070699_100011030
131 Ga0070699_100273854
132 Ga0070697_100004839
133 Ga0070697_100097839
134 Ga0070695_100038570
135 Ga0070704_100014491
136 Ga0068860_100015320
137 Ga0070717_10948699
138 Ga0097621_100440996
139 Ga0075430_100043028
140 Ga0075433_10309931
141 Ga0075433_10313303
142 Ga0075434_100136618
143 Ga0075435_100101168
144 Ga0099794_10000003
145 Ga0111539_10000663
146 Ga0105245_10214506
147 Ga0114129_10048746
148 Ga0114129_10378218
149 Ga0114129_10404843
150 Ga0157371_10001432
151 Ga0157370_10021924
152 Ga0157375_10011761
153 Ga0163163_10254220
154 Ga0157380_10023665
155 Ga0157379_10024033
156 Ga0207680_10097902
157 Ga0207684_10000121
158 Ga0207684_10001931
159 Ga0207684_10011692
160 Ga0207646_10001192
161 Ga0207646_10020595
162 Ga0207658_10258890
163 Ga0209588_1000001
164 Ga0207428_10030129
165 Ga0268264_10028262
166 Ga0265316_10003119
167 Ga0307508_10019530
168 Ga0307405_10483498
169 Ga0316577_10035754
170 Ga0373934_0130882
171 Ga0373949_0017711
172 Ga0373923_0037421
173 Ga0373933_0013102
174 Ga0373937_0023572
175 Ga0373937_0057365
176 Ga0316584_0118004
177 Ga0316584_0438422
178 Ga0400490_26487
179 Ga0400485_12879
180 Ga0400488_29379
181 Ga0400486_21861
182 Ga0400483_134088
183 Ga0400483_199224
184 Ga0400489_22168
185 Ga0400487_38608
186 Ga0436363_1479011
187 Ga0450901_004862
188 Ga0451577_0034144
189 Ga0451577_0069350
190 Ga0453683_0003045
191 Ga0453684_0004151
192 Ga0453684_0068714
193 Ga0453684_0122636
194 Ga0451576_0001251
195 Ga0451576_0055070
196 Ga0451576_0120993
197 Ga0451576_0239055
198 Ga0495580_0419846
199 Ga0495630_0704156
200 Ga0495663_0001585
201 Ga0495633_0007811
202 Ga0495658_0014559
203 Ga0496114_0000835
204 Ga0501031_0054706
205 Ga0501036_0277259
206 Ga0501040_0071330
207 Ga0501040_0073741
208 Ga0501041_0144239
209 Ga0501041_0187552
210 Ga0501074_0116928
211 Ga0501075_0099389
212 Ga0501075_0230421
213 Ga0501081_0089422
214 Ga0501035_0199263
215 nmdc:mga05p37_166890_c1
216 nmdc:mga05p37_330719_c1
217 nmdc:mga05p37_917992_c1
218 nmdc:mga0qj67_27312_c1
219 nmdc:mga08y16_145118_c1
220 nmdc:mga08y16_2682_c1
221 nmdc:mga0n895_339985_c1
222 nmdc:mga0rr50_149279_c1
223 nmdc:mga0a205_117348_c1
224 nmdc:mga0a205_19277_c1
225 Ga0530510_0214033
226 2842757876
227 2919500366
228 8055695526

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03588

Leu_Phe_trans

Leucyl/phenylalanyl-tRNA protein transferase

39

210

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z3o-assembly1.cif.gz_A complex structure of lf-transferase and phenylalanine 0.9495 1 212
2z3l-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9457 1 212
2cxa-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.945 2 213
2dps-assembly1.cif.gz_A structure of leucyl/phenylalanyl-trna-protein transferase 0.945 1 213
2z3o-assembly1.cif.gz_A complex structure of lf-transferase and phenylalanine 0.9365 1 212
ID Description Score Start End Superfamily
2dpsB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9578 1 58 3.30.70.3550
2z3lB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9487 1 58 3.30.70.3550
2z3kA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain 0.9254 60 213 3.40.630.70
2z3lB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9035 1 58 3.30.70.3550
2dpsB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.8976 1 58 3.30.70.3550
ID Description Score Start End GO Terms
AF-A0A519P5Y6-F1-model_v4 deleted 0.9792 1 211
AF-A0A563UEF9-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9783 1 190 GO:0005737
GO:0008914
GO:0030163
AF-A0A369PZB1-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9774 1 211 GO:0005737
GO:0008914
GO:0030163
AF-A0A2S7WDL3-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9759 3 211 GO:0005737
GO:0008914
GO:0030163
AF-A0A2S1SEM8-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9751 3 210 GO:0005737
GO:0008914
GO:0030163

Map