F079467

General Info

Members Datasets Scaffolds Average Seq Length
114 76 113 317

Family's Representative Sequence

Representative Sequence 3300031712|Ga0265342_10016872|Ga0265342_100168723
Length 357
Sequence MAKPDLPSPTFHLPILITGPTATGKSEIALLLAEQLGGEIISADSMQVYRGLDIGTAKPSPADRVRVPHHLIDICDLTGSFDAAQFARLAHHAAAEIQSRRRVPVLCGGTGLYIKAFLEGLGEAPPADAQLRAELEAVPLENLLAELRERDPAAYEKIDKQNPRRVIRAVEVIRLTGKPFSAQRSRWGEPSHRPRSVDIPVRGFTGHSCPVSAEADVVSPPHELATGKSPEPADRNVCPTSMIVFTRSPDDLRIRINARVDAMFARGLVEETRELLKHGLAENKTAMQAIGYRQVVEHLHGERSLAETIELVKIRTRQFAKRQLTWFRAQKNLEWLELKPDDSPEKWLPEISRAIRK

Samples

Sample ID Description Type Environment
1 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
35 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
36 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
37 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
38 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
39 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
40 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
41 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
44 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
45 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
46 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
47 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
54 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
55 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
60 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
61 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
62 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
63 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
64 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
65 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
66 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
67 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
68 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
73 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
75 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
76 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 0
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10129018 3300003323 Unclassified 3212
2 Ga0055530_10006944 3300003791 Unclassified 4891
3 Ga0070690_100032918 3300005330 Bacteria 3241
4 Ga0070690_100062671 3300005330 Bacteria 2398
5 Ga0070714_100005087 3300005435 Bacteria 10008
6 Ga0070701_10070774 3300005438 Bacteria 1864
7 Ga0070700_100077346 3300005441 Bacteria 2139
8 Ga0070694_100005023 3300005444 Bacteria 7981
9 Ga0070686_100001138 3300005544 Bacteria 15272
10 Ga0070704_100001978 3300005549 Bacteria 11337
11 Ga0068855_100038656 3300005563 Bacteria 5669
12 Ga0068855_100051757 3300005563 Bacteria 4837
13 Ga0068855_100070853 3300005563 Bacteria 4055
14 Ga0068856_100028216 3300005614 Bacteria 5480
15 Ga0068859_100014999 3300005617 Bacteria 7778
16 Ga0068866_10045902 3300005718 Bacteria 2194
17 Ga0068861_100095385 3300005719 Bacteria 2356
18 Ga0068858_100138877 3300005842 Unclassified 2281
19 Ga0075428_100168045 3300006844 Unclassified 2379
20 Ga0097620_100014999 3300006931 Bacteria 7778
21 Ga0105240_10007317 3300009093 Bacteria 16063
22 Ga0111539_10154638 3300009094 Unclassified 2684
23 Ga0105248_10075241 3300009177 Bacteria 3795
24 Ga0105238_10081292 3300009551 Bacteria 3230
25 Ga0105249_10436303 3300009553 Bacteria 1346
26 Ga0163163_10081321 3300014325 Unclassified 3241
27 Ga0157376_10029152 3300014969 Bacteria 4395
28 Ga0209050_1000324 3300025298 Bacteria 95696
29 Ga0207707_10423835 3300025912 Bacteria 1141
30 Ga0207695_10012981 3300025913 Bacteria 9954
31 Ga0207664_10005924 3300025929 Bacteria 8364
32 Ga0207686_10404139 3300025934 Bacteria 1041
33 Ga0207711_10287948 3300025941 Bacteria 1514
34 Ga0207667_10036301 3300025949 Bacteria 5283
35 Ga0207667_10052050 3300025949 Bacteria 4315
36 Ga0207667_10058225 3300025949 Bacteria 4054
37 Ga0207708_10086606 3300026075 Bacteria 2411
38 Ga0265337_1000477 3300028556 Bacteria 21235
39 Ga0265337_1007976 3300028556 Bacteria 3900
40 Ga0265337_1035672 3300028556 Bacteria 1455
41 Ga0265326_10050303 3300028558 Bacteria 1180
42 Ga0265319_1010410 3300028563 Bacteria 3882
43 Ga0265319_1014627 3300028563 Bacteria 3072
44 Ga0265334_10016447 3300028573 Bacteria 3059
45 Ga0265334_10085777 3300028573 Bacteria 1155
46 Ga0265318_10073476 3300028577 Bacteria 1266
47 Ga0265323_10000018 3300028653 Bacteria 91203
48 Ga0265323_10011361 3300028653 Bacteria 3597
49 Ga0265322_10004104 3300028654 Bacteria 4356
50 Ga0265336_10006053 3300028666 Bacteria 4397
51 Ga0265338_10003663 3300028800 Bacteria 21403
52 Ga0265338_10005880 3300028800 Bacteria 15822
53 Ga0265338_10005899 3300028800 Bacteria 15793
54 Ga0265338_10014878 3300028800 Bacteria 8604
55 Ga0265338_10031504 3300028800 Bacteria 5197
56 Ga0265338_10033173 3300028800 Bacteria 5017
57 Ga0265338_10034926 3300028800 Bacteria 4846
58 Ga0265338_10048440 3300028800 Bacteria 3865
59 Ga0265338_10050039 3300028800 Bacteria 3781
60 Ga0265338_10112142 3300028800 Unclassified 2194
61 Ga0265338_10184982 3300028800 Unclassified 1584
62 Ga0265324_10006853 3300029957 Bacteria 4695
63 Ga0265324_10013257 3300029957 Bacteria 3080
64 Ga0265324_10042239 3300029957 Bacteria 1576
65 Ga0265325_10026954 3300031241 Bacteria 3109
66 Ga0265329_10045188 3300031242 Bacteria 1408
67 Ga0265340_10009490 3300031247 Bacteria 5219
68 Ga0265339_10011589 3300031249 Bacteria 5418
69 Ga0265339_10139467 3300031249 Bacteria 1234
70 Ga0265327_10063066 3300031251 Unclassified 1883
71 Ga0265316_10004590 3300031344 Bacteria 13704
72 Ga0265316_10016055 3300031344 Bacteria 6514
73 Ga0265316_10018969 3300031344 Bacteria 5902
74 Ga0265316_10027196 3300031344 Bacteria 4741
75 Ga0265316_10071410 3300031344 Bacteria 2676
76 Ga0265313_10022258 3300031595 Bacteria 3443
77 Ga0265314_10016243 3300031711 Bacteria 5890
78 Ga0265314_10042224 3300031711 Bacteria 3256
79 Ga0265314_10056379 3300031711 Bacteria 2705
80 Ga0265342_10016872 3300031712 Bacteria 4760
81 Ga0265342_10018614 3300031712 Bacteria 4491
82 Ga0373935_0006434 3300035692 Bacteria 7013
83 Ga0373927_0033322 3300035695 Bacteria 3354
84 Ga0373927_0340079 3300035695 Bacteria 989
85 Ga0373937_0086973 3300036401 Bacteria 2892
86 Ga0451577_0000415 3300042876 Bacteria 77375
87 Ga0451577_0008061 3300042876 Bacteria 10277
88 Ga0451577_0072229 3300042876 Bacteria 3078
89 Ga0453684_0002763 3300044712 Bacteria 41544
90 Ga0453684_0053371 3300044712 Bacteria 5276
91 Ga0453684_0269872 3300044712 Bacteria 1945
92 Ga0451576_0098899 3300045051 Bacteria 3035
93 Ga0495618_0051432 3300046514 Unclassified 2603
94 Ga0495630_0106071 3300046517 Bacteria 2128
95 Ga0495640_0038574 3300046533 Bacteria 3360
96 Ga0495586_0109784 3300046535 Bacteria 1534
97 Ga0495645_0237770 3300046543 Bacteria 1217
98 Ga0495634_0028198 3300046642 Bacteria 3899
99 Ga0495669_0056184 3300046684 Bacteria 1774
100 Ga0495613_0131148 3300046689 Bacteria 1795
101 Ga0495680_0053070 3300047322 Bacteria 3157
102 Ga0501031_0000638 3300049568 Bacteria 20752
103 Ga0501032_0011852 3300049569 Bacteria 6245
104 Ga0501033_0017641 3300049570 Bacteria 5391
105 Ga0501033_0099081 3300049570 Bacteria 2128
106 Ga0501037_0042860 3300049573 Bacteria 3326
107 Ga0501257_037564 3300049686 Bacteria 1182
108 Ga0501035_0008344 3300049822 Bacteria 9642
109 Ga0501035_0016718 3300049822 Bacteria 6764
110 Ga0501044_0000611 3300049823 Bacteria 43362
111 Ga0501044_0027551 3300049823 Bacteria 6004
112 nmdc:mga0qj67_76418_c2 3300050509 Bacteria 2045
113 nmdc:mga06r32_134990_c1 3300050510 Unclassified 2442

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10007317 Ga0105240_1000731716 264
2 3300035695 Ga0373927_0340079 Ga0373927_0340079_62_967 278
3 3300042876 Ga0451577_0072229 Ga0451577_0072229_824_1750 279
4 3300006844 Ga0075428_100168045 Ga0075428_1001680452 288
5 3300050509 nmdc:mga0qj67_76418_c2 nmdc:mga0qj67_76418_c2_930_1802 288
6 3300050510 nmdc:mga06r32_134990_c1 nmdc:mga06r32_134990_c1_101_973 288
7 iso_pu_bacteria 2883068021 2883072246 291
8 3300046684 Ga0495669_0056184 Ga0495669_0056184_149_1054 293
9 3300049686 Ga0501257_037564 Ga0501257_037564_182_1075 293
10 3300031344 Ga0265316_10071410 Ga0265316_100714102 294
11 3300035695 Ga0373927_0033322 Ga0373927_0033322_88_981 295
12 3300003791 Ga0055530_10006944 Ga0055530_100069445 297
13 3300005563 Ga0068855_100051757 Ga0068855_1000517575 297
14 3300025298 Ga0209050_1000324 Ga0209050_10003249 297
15 3300005718 Ga0068866_10045902 Ga0068866_100459022 299
16 3300025949 Ga0207667_10058225 Ga0207667_100582252 299
17 3300028800 Ga0265338_10033173 Ga0265338_100331732 299
18 3300029957 Ga0265324_10042239 Ga0265324_100422392 299
19 3300028653 Ga0265323_10011361 Ga0265323_100113615 300
20 3300028800 Ga0265338_10005880 Ga0265338_1000588015 300
21 3300031344 Ga0265316_10004590 Ga0265316_100045902 300
22 3300031344 Ga0265316_10016055 Ga0265316_100160554 300
23 3300005441 Ga0070700_100077346 Ga0070700_1000773462 301
24 3300014969 Ga0157376_10029152 Ga0157376_100291524 301
25 3300026075 Ga0207708_10086606 Ga0207708_100866062 301
26 3300028556 Ga0265337_1000477 Ga0265337_100047711 301
27 3300028558 Ga0265326_10050303 Ga0265326_100503031 301
28 3300028666 Ga0265336_10006053 Ga0265336_100060535 301
29 3300028800 Ga0265338_10014878 Ga0265338_100148785 301
30 3300028800 Ga0265338_10034926 Ga0265338_100349263 301
31 3300046689 Ga0495613_0131148 Ga0495613_0131148_784_1749 301
32 3300005719 Ga0068861_100095385 Ga0068861_1000953853 302
33 3300009094 Ga0111539_10154638 Ga0111539_101546382 302
34 3300009553 Ga0105249_10436303 Ga0105249_104363032 302
35 3300014325 Ga0163163_10081321 Ga0163163_100813212 302
36 3300042876 Ga0451577_0008061 Ga0451577_0008061_2474_3406 302
37 3300044712 Ga0453684_0269872 Ga0453684_0269872_434_1366 302
38 3300028800 Ga0265338_10003663 Ga0265338_1000366318 303
39 3300029957 Ga0265324_10013257 Ga0265324_100132573 303
40 3300031247 Ga0265340_10009490 Ga0265340_100094905 303
41 3300035692 Ga0373935_0006434 Ga0373935_0006434_3261_4307 303
42 3300042876 Ga0451577_0000415 Ga0451577_0000415_29353_30300 303
43 3300044712 Ga0453684_0053371 Ga0453684_0053371_2677_3624 303
44 3300045051 Ga0451576_0098899 Ga0451576_0098899_1362_2420 303
45 3300028556 Ga0265337_1007976 Ga0265337_10079763 304
46 3300028563 Ga0265319_1014627 Ga0265319_10146274 304
47 3300028573 Ga0265334_10016447 Ga0265334_100164472 304
48 3300028577 Ga0265318_10073476 Ga0265318_100734762 304
49 3300028800 Ga0265338_10005899 Ga0265338_1000589914 304
50 3300028800 Ga0265338_10184982 Ga0265338_101849822 304
51 3300031241 Ga0265325_10026954 Ga0265325_100269543 304
52 3300031249 Ga0265339_10011589 Ga0265339_100115895 304
53 3300031344 Ga0265316_10018969 Ga0265316_100189692 304
54 3300031595 Ga0265313_10022258 Ga0265313_100222583 304
55 3300031711 Ga0265314_10042224 Ga0265314_100422244 304
56 3300031711 Ga0265314_10056379 Ga0265314_100563792 304
57 3300031712 Ga0265342_10018614 Ga0265342_100186141 304
58 3300049570 Ga0501033_0099081 Ga0501033_0099081_778_1764 304
59 3300049822 Ga0501035_0008344 Ga0501035_0008344_7251_8237 304
60 3300049823 Ga0501044_0027551 Ga0501044_0027551_181_1167 304
61 3300005330 Ga0070690_100032918 Ga0070690_1000329183 305
62 3300005330 Ga0070690_100062671 Ga0070690_1000626713 305
63 3300005438 Ga0070701_10070774 Ga0070701_100707743 305
64 3300005444 Ga0070694_100005023 Ga0070694_1000050235 305
65 3300005544 Ga0070686_100001138 Ga0070686_1000011385 305
66 3300005549 Ga0070704_100001978 Ga0070704_1000019786 305
67 3300005563 Ga0068855_100038656 Ga0068855_1000386566 305
68 3300005617 Ga0068859_100014999 Ga0068859_1000149996 305
69 3300005842 Ga0068858_100138877 Ga0068858_1001388772 305
70 3300006931 Ga0097620_100014999 Ga0097620_1000149996 305
71 3300009551 Ga0105238_10081292 Ga0105238_100812922 305
72 3300028556 Ga0265337_1035672 Ga0265337_10356721 305
73 3300028800 Ga0265338_10050039 Ga0265338_100500395 305
74 3300029957 Ga0265324_10006853 Ga0265324_100068533 305
75 3300046543 Ga0495645_0237770 Ga0495645_0237770_41_1015 305
76 3300003323 rootH1_10129018 rootH1_101290183 306
77 3300005435 Ga0070714_100005087 Ga0070714_1000050879 306
78 3300005563 Ga0068855_100070853 Ga0068855_1000708532 306
79 3300005614 Ga0068856_100028216 Ga0068856_1000282164 306
80 3300009177 Ga0105248_10075241 Ga0105248_100752413 306
81 3300025912 Ga0207707_10423835 Ga0207707_104238351 306
82 3300025913 Ga0207695_10012981 Ga0207695_100129812 306
83 3300025929 Ga0207664_10005924 Ga0207664_100059247 306
84 3300025934 Ga0207686_10404139 Ga0207686_104041391 306
85 3300025941 Ga0207711_10287948 Ga0207711_102879482 306
86 3300025949 Ga0207667_10036301 Ga0207667_100363014 306
87 3300025949 Ga0207667_10052050 Ga0207667_100520502 306
88 3300028563 Ga0265319_1010410 Ga0265319_10104102 306
89 3300028573 Ga0265334_10085777 Ga0265334_100857772 306
90 3300028653 Ga0265323_10000018 Ga0265323_1000001838 306
91 3300028654 Ga0265322_10004104 Ga0265322_100041042 306
92 3300028800 Ga0265338_10031504 Ga0265338_100315043 306
93 3300028800 Ga0265338_10048440 Ga0265338_100484406 306
94 3300028800 Ga0265338_10112142 Ga0265338_101121422 306
95 3300031242 Ga0265329_10045188 Ga0265329_100451882 306
96 3300031249 Ga0265339_10139467 Ga0265339_101394671 306
97 3300031251 Ga0265327_10063066 Ga0265327_100630663 306
98 3300031344 Ga0265316_10027196 Ga0265316_100271962 306
99 3300031711 Ga0265314_10016243 Ga0265314_100162435 306
100 3300031712 Ga0265342_10016872 Ga0265342_100168723 306
101 3300036401 Ga0373937_0086973 Ga0373937_0086973_1102_2058 306
102 3300044712 Ga0453684_0002763 Ga0453684_0002763_4930_5868 306
103 3300046514 Ga0495618_0051432 Ga0495618_0051432_409_1365 306
104 3300046517 Ga0495630_0106071 Ga0495630_0106071_440_1396 306
105 3300046533 Ga0495640_0038574 Ga0495640_0038574_522_1478 306
106 3300046535 Ga0495586_0109784 Ga0495586_0109784_352_1332 306
107 3300046642 Ga0495634_0028198 Ga0495634_0028198_1553_2509 306
108 3300047322 Ga0495680_0053070 Ga0495680_0053070_1318_2274 306
109 3300049568 Ga0501031_0000638 Ga0501031_0000638_7569_8534 306
110 3300049569 Ga0501032_0011852 Ga0501032_0011852_427_1392 306
111 3300049570 Ga0501033_0017641 Ga0501033_0017641_100_1065 306
112 3300049573 Ga0501037_0042860 Ga0501037_0042860_2192_3157 306
113 3300049822 Ga0501035_0016718 Ga0501035_0016718_3876_4841 306
114 3300049823 Ga0501044_0000611 Ga0501044_0000611_17588_18553 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01715

IPPT

IPP transferase

47

205

0.93

PF01715

IPPT

IPP transferase

219

330

0.89

PF01745

IPT

Isopentenyl transferase

14

119

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qgn-assembly1.cif.gz_A crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. 0.9326 11 302
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.9186 7 302
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.8988 11 302
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.8815 7 302
2qgn-assembly1.cif.gz_A crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. 0.8669 11 302
ID Description Score Start End Superfamily
3crrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9427 7 118 3.40.50.300
3exaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9378 12 120 3.40.50.300
af_P16384_121_194_1.10.20.140 Mainly Alpha;Orthogonal Bundle;Histone, subunit A; 0.9324 121 179 1.10.20.140
2zm5B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9095 10 302 3.40.50.300
3d3qB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8998 9 120 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A496JYQ4-F1-model_v4 deleted 0.9842 10 108
AF-A0A7C5CXF9-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) 0.9778 10 179 GO:0005524
GO:0006400
GO:0052381
AF-A0A832HRA5-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) 0.9755 9 182 GO:0005524
GO:0006400
GO:0052381
AF-A0A7V1JL28-F1-model_v4 tRNA (Adenosine(37)-N6)-dimethylallyltransferase MiaA 0.9704 7 105 GO:0005524
GO:0006400
GO:0052381
AF-A0A832HRA5-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) 0.97 9 182 GO:0005524
GO:0006400
GO:0052381

Feature Viewer

pLDDT pTM Quality
86.22 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map