F078531

General Info

Members Datasets Scaffolds Average Seq Length
114 96 228 139

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10191678|Ga0105243_101916783
Length 162
Sequence LPPSVRATSIGFDNHVEPKGGIMVTLNPYLNFPGNAKEAMEFYHSVFGGELTTSTFAEFGQADDPADADKIMHGQLEGENGIVLMGADTPSALGDPDTGGPISISLSGGRDDDATLRGYWEQLLASGSQIVPLEVAPWGDAFGMCTDRYGVTWLVNISANAA

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
25 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
26 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
36 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
37 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
38 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
39 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
44 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
45 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
46 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
47 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
48 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
49 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
50 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
51 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
52 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
55 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
56 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
57 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
58 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
59 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
60 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
61 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
62 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
63 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
64 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
65 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
66 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
67 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
68 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
69 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
70 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
71 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
72 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
73 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
74 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
75 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
76 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
79 2643221549 Agromyces sp. Root1464 Isolate Unclassified
80 2643221572 Leifsonia sp. Root60 Isolate Unclassified
81 2643221613 Oerskovia sp. Root22 Isolate Unclassified
82 2643221619 Agromyces sp. Root81 Isolate Unclassified
83 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
84 2643221721 Oerskovia sp. Root918 Isolate Unclassified
85 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
86 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
87 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
88 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
89 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
90 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
91 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
92 2919069694 Microbacterium sp. 1154 Isolate Unclassified
93 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
94 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
95 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
96 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.95
Metatranscriptomes 4.39
Isolates 16.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.88
Bulb 0
Endosphere 3.51
Nodule 0
Rhizoplane 6.14
Rhizosphere 70.18
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10191678 3300009148 Bacteria 1786
2 JGI25407J50210_10038848 3300003373 Bacteria 1221
3 Ga0065714_10007228 3300005288 Bacteria 2899
4 Ga0065714_10266060 3300005288 Bacteria 748
5 Ga0070682_101060512 3300005337 Bacteria 676
6 Ga0070668_100369388 3300005347 Bacteria 1218
7 Ga0070667_100593762 3300005367 Bacteria 1020
8 Ga0070709_11152261 3300005434 Bacteria 622
9 Ga0070714_101239958 3300005435 Bacteria 728
10 Ga0070711_101568561 3300005439 Bacteria 575
11 Ga0070708_100072404 3300005445 Bacteria 3105
12 Ga0070707_100262692 3300005468 Bacteria 1679
13 Ga0070698_100075157 3300005471 Bacteria 3383
14 Ga0070699_100082588 3300005518 Bacteria 2801
15 Ga0070699_100146532 3300005518 Bacteria 2086
16 Ga0070697_100042713 3300005536 Bacteria 3669
17 Ga0068853_101149855 3300005539 Bacteria 749
18 Ga0070672_101223497 3300005543 Bacteria 669
19 Ga0070664_101854330 3300005564 Bacteria 572
20 Ga0068860_101206263 3300005843 Bacteria 777
21 Ga0081455_10387425 3300005937 Bacteria 974
22 Ga0105245_10908657 3300009098 Bacteria 922
23 Ga0105241_10206602 3300009174 Bacteria 1643
24 Ga0099796_10266741 3300010159 Bacteria 716
25 Ga0157371_10429568 3300013102 Bacteria 969
26 Ga0157377_11095567 3300014745 Bacteria 610
27 Ga0163161_10348517 3300017792 Bacteria 1177
28 Ga0206356_10364970 3300020070 Bacteria 1526
29 Ga0206350_11107711 3300020080 Bacteria 1315
30 Ga0224712_10011204 3300022467 Bacteria 2772
31 Ga0207654_10107638 3300025911 Unclassified 1728
32 Ga0207646_10262329 3300025922 Bacteria 1561
33 Ga0207687_10142583 3300025927 Bacteria 1819
34 Ga0207664_10753248 3300025929 Bacteria 876
35 Ga0207658_10604259 3300025986 Bacteria 986
36 Ga0307408_100805434 3300031548 Bacteria 853
37 Ga0307405_10576437 3300031731 Bacteria 915
38 Ga0307413_10699291 3300031824 Bacteria 842
39 Ga0307413_11141289 3300031824 Bacteria 675
40 Ga0307413_11431681 3300031824 Bacteria 609
41 Ga0307518_10303768 3300031838 Bacteria 968
42 Ga0307406_10380790 3300031901 Bacteria 1112
43 Ga0307406_10591464 3300031901 Bacteria 914
44 Ga0307407_10814912 3300031903 Bacteria 711
45 Ga0307412_10177184 3300031911 Bacteria 1600
46 Ga0307409_100642175 3300031995 Bacteria 1054
47 Ga0307409_100876303 3300031995 Bacteria 910
48 Ga0307409_101315747 3300031995 Bacteria 748
49 Ga0307416_100182601 3300032002 Bacteria 1968
50 Ga0307416_101337781 3300032002 Bacteria 822
51 Ga0307416_102018921 3300032002 Bacteria 679
52 Ga0307416_102028482 3300032002 Bacteria 678
53 Ga0307414_10204174 3300032004 Bacteria 1610
54 Ga0307414_10586778 3300032004 Bacteria 998
55 Ga0307414_11375111 3300032004 Bacteria 656
56 Ga0307411_10134098 3300032005 Bacteria 1815
57 Ga0307411_10971417 3300032005 Bacteria 759
58 Ga0307415_100014238 3300032126 Bacteria 4669
59 Ga0373947_1002548 3300035725 Bacteria 570
60 Ga0451789_0273169 3300041443 Bacteria 503
61 Ga0451791_1691671 3300041451 Bacteria 1593
62 Ga0451806_459685 3300041462 Bacteria 751
63 Ga0450903_036277 3300042138 Bacteria 736
64 Ga0466957_0147880 3300044842 Bacteria 1518
65 Ga0466960_0095709 3300044901 Bacteria 1521
66 Ga0466967_0249121 3300045976 Bacteria 1696
67 Ga0495638_0070819 3300046460 Bacteria 2134
68 Ga0495598_0359354 3300046537 Bacteria 562
69 Ga0495656_0233882 3300046615 Bacteria 923
70 Ga0495659_0219441 3300046664 Bacteria 785
71 Ga0495680_1087962 3300047322 Bacteria 506
72 Ga0496100_0736259 3300048903 Bacteria 771
73 Ga0496102_1157497 3300048905 Bacteria 693
74 Ga0496104_1285917 3300048907 Bacteria 635
75 Ga0496112_0142920 3300048915 Bacteria 2362
76 Ga0496117_0000071 3300048920 Bacteria 242170
77 Ga0496117_0002242 3300048920 Bacteria 24941
78 Ga0496117_0150732 3300048920 Bacteria 1377
79 Ga0496118_0000601 3300048921 Bacteria 59471
80 Ga0496120_0129145 3300048923 Bacteria 1297
81 Ga0496122_0086459 3300048925 Bacteria 2158
82 Ga0496122_0303498 3300048925 Bacteria 859
83 Ga0496123_0109566 3300048926 Bacteria 1582
84 Ga0496124_0002036 3300048927 Bacteria 27465
85 Ga0496124_0078120 3300048927 Bacteria 2728
86 Ga0496124_0196952 3300048927 Bacteria 1536
87 Ga0501067_0124803 3300049583 Bacteria 1433
88 Ga0501069_0119291 3300049585 Bacteria 1506
89 Ga0495619_0245820 3300053085 Bacteria 1240
90 Ga0500573_0043878 3300053140 Bacteria 2579
91 Ga0500604_0000482 3300053151 Bacteria 10992
92 Ga0500616_0000010 3300053153 Bacteria 761410
93 Ga0500645_125617 3300053730 Bacteria 714
94 Ga0587082_071592 3300059504 Bacteria 705
95 Ga0587078_077043 3300059646 Bacteria 529
96 2587864125 2585428094 Bacteria 3604039
97 2643768784 2643221549 Bacteria 4042819
98 2643877671 2643221572 Bacteria 3614809
99 2644081034 2643221613 Bacteria 4622396
100 2644112230 2643221619 Bacteria 4158469
101 2644384726 2643221669 Bacteria 3611286
102 2644663655 2643221721 Bacteria 4486924
103 2723643332 2721755702 Bacteria 4373124
104 2753301787 2751185788 Bacteria 4541048
105 2774381223 2773857758 Bacteria 3592392
106 2857734253 2857733635 Bacteria 3532004
107 2895662509 2895660088 Bacteria 3782833
108 2908680363 2908678064 Bacteria 3482747
109 2919043723 2919042368 Bacteria 3905917
110 2919072680 2919069694 Bacteria 3622919
111 2919445373 2919443155 Bacteria 4072969
112 2928106497 2928104781 Bacteria 3877447
113 2984553944 2984551494 Bacteria 3877562
114 8057346299 8057345674 Bacteria 4160394
115 Ga0105243_10191678
116 JGI25407J50210_10038848
117 Ga0065714_10007228
118 Ga0065714_10266060
119 Ga0070682_101060512
120 Ga0070668_100369388
121 Ga0070667_100593762
122 Ga0070709_11152261
123 Ga0070714_101239958
124 Ga0070711_101568561
125 Ga0070708_100072404
126 Ga0070707_100262692
127 Ga0070698_100075157
128 Ga0070699_100082588
129 Ga0070699_100146532
130 Ga0070697_100042713
131 Ga0068853_101149855
132 Ga0070672_101223497
133 Ga0070664_101854330
134 Ga0068860_101206263
135 Ga0081455_10387425
136 Ga0105245_10908657
137 Ga0105241_10206602
138 Ga0099796_10266741
139 Ga0157371_10429568
140 Ga0157377_11095567
141 Ga0163161_10348517
142 Ga0206356_10364970
143 Ga0206350_11107711
144 Ga0224712_10011204
145 Ga0207654_10107638
146 Ga0207646_10262329
147 Ga0207687_10142583
148 Ga0207664_10753248
149 Ga0207658_10604259
150 Ga0307408_100805434
151 Ga0307405_10576437
152 Ga0307413_10699291
153 Ga0307413_11141289
154 Ga0307413_11431681
155 Ga0307518_10303768
156 Ga0307406_10380790
157 Ga0307406_10591464
158 Ga0307407_10814912
159 Ga0307412_10177184
160 Ga0307409_100642175
161 Ga0307409_100876303
162 Ga0307409_101315747
163 Ga0307416_100182601
164 Ga0307416_101337781
165 Ga0307416_102018921
166 Ga0307416_102028482
167 Ga0307414_10204174
168 Ga0307414_10586778
169 Ga0307414_11375111
170 Ga0307411_10134098
171 Ga0307411_10971417
172 Ga0307415_100014238
173 Ga0373947_1002548
174 Ga0451789_0273169
175 Ga0451791_1691671
176 Ga0451806_459685
177 Ga0450903_036277
178 Ga0466957_0147880
179 Ga0466960_0095709
180 Ga0466967_0249121
181 Ga0495638_0070819
182 Ga0495598_0359354
183 Ga0495656_0233882
184 Ga0495659_0219441
185 Ga0495680_1087962
186 Ga0496100_0736259
187 Ga0496102_1157497
188 Ga0496104_1285917
189 Ga0496112_0142920
190 Ga0496117_0000071
191 Ga0496117_0002242
192 Ga0496117_0150732
193 Ga0496118_0000601
194 Ga0496120_0129145
195 Ga0496122_0086459
196 Ga0496122_0303498
197 Ga0496123_0109566
198 Ga0496124_0002036
199 Ga0496124_0078120
200 Ga0496124_0196952
201 Ga0501067_0124803
202 Ga0501069_0119291
203 Ga0495619_0245820
204 Ga0500573_0043878
205 Ga0500604_0000482
206 Ga0500616_0000010
207 Ga0500645_125617
208 Ga0587082_071592
209 Ga0587078_077043
210 2587864125
211 2643768784
212 2643877671
213 2644081034
214 2644112230
215 2644384726
216 2644663655
217 2723643332
218 2753301787
219 2774381223
220 2857734253
221 2895662509
222 2908680363
223 2919043723
224 2919072680
225 2919445373
226 2928106497
227 2984553944
228 8057346299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

25

155

0.86

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

24

156

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8588 2 134
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8529 2 134
3l20-assembly1.cif.gz_A crystal structure of a hypothetical protein from staphylococcus aureus 0.7969 1 136
3l20-assembly1.cif.gz_A crystal structure of a hypothetical protein from staphylococcus aureus 0.7918 1 136
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.772 3 132
ID Description Score Start End Superfamily
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9269 80 132 3.30.720.110
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8783 79 132 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8644 10 134 3.10.180.10
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8511 10 134 3.10.180.10
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8368 80 132 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A6G3T8C4-F1-model_v4 VOC family protein 0.9809 1 136
AF-A0A850DFP5-F1-model_v4 VOC family protein 0.9759 1 133
AF-A0A3E0VF14-F1-model_v4 PhnB-like domain-containing protein 0.9755 3 134
AF-A0A239DTI9-F1-model_v4 PhnB protein 0.9752 1 133
AF-A0A3N5LER3-F1-model_v4 VOC family protein 0.9745 12 136

Map