F075940

General Info

Members Datasets Scaffolds Average Seq Length
113 78 226 265

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0179092|Ga0501047_0179092_296_1180
Length 294
Sequence LDERRLSGTGHLNNTKRIMSDSEILKIKDLHVSTTEGKEILRGVNLEIKRGEVHALMGPNGSGKSTLGYAIMGHPGYEVTQGSITLDGEDVLAMEPNERARAGIFLAFQRPMAIPGVKMADFLRHAATNVRRPDRKEGEELIPMREFRKELNQKMEQLRMDKEFARRYVNDGFSGGEMKRAEILQLAMLRPKFAILDETDSGLDVDAVRLASQSIADIGGKDMGILIITHHEHLLEHNRPDFTHVILGGRIVETGGPVLALELHKQGYDRIRAAYPEEAAADAALKEKEPAGTH

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
12 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
13 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
14 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
15 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
16 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
17 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
18 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
24 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
25 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
26 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
27 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
28 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
29 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
30 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
31 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
32 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
33 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
34 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
35 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
36 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
39 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
40 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
41 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
42 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
43 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
44 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
45 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
46 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
47 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
48 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
49 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
50 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
51 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
52 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
53 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
55 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
56 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
58 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
59 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
60 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
61 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
62 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
63 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
64 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
66 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
67 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
68 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
69 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
70 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
71 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
72 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
76 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
77 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
78 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.73
Metatranscriptomes 9.73
Isolates 3.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.42
Nodule 0
Rhizoplane 5.31
Rhizosphere 74.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0179092 3300049581 Bacteria 1986
2 Ga0065712_10069143 3300005290 Bacteria 7913
3 Ga0065707_10007864 3300005295 Bacteria 2457
4 Ga0070682_100394498 3300005337 Bacteria 1045
5 Ga0070667_100149357 3300005367 Bacteria 2052
6 Ga0070714_100356261 3300005435 Bacteria 1375
7 Ga0070665_100000481 3300005548 Bacteria 57473
8 Ga0068858_100005610 3300005842 Bacteria 12270
9 Ga0081455_10113798 3300005937 Bacteria 2145
10 Ga0075365_10078373 3300006038 Bacteria 2234
11 Ga0105245_10431968 3300009098 Bacteria 1322
12 Ga0114129_11301495 3300009147 Bacteria 901
13 Ga0105249_10526930 3300009553 Bacteria 1229
14 Ga0105239_10125758 3300010375 Bacteria 2849
15 Ga0105239_10702429 3300010375 Bacteria 1156
16 Ga0206356_10810780 3300020070 Bacteria 3038
17 Ga0213874_10031674 3300021377 Bacteria 1532
18 Ga0213874_10048144 3300021377 Bacteria 1299
19 Ga0213874_10067524 3300021377 Bacteria 1133
20 Ga0213875_10009009 3300021388 Bacteria 5076
21 Ga0213875_10025006 3300021388 Bacteria 2847
22 Ga0207669_10582861 3300025937 Bacteria 907
23 Ga0207711_10437023 3300025941 Bacteria 1218
24 Ga0207683_10203714 3300026121 Bacteria 1799
25 Ga0268266_10000486 3300028379 Bacteria 56915
26 Ga0268266_10000579 3300028379 Bacteria 50615
27 Ga0265760_10016877 3300031090 Bacteria 2096
28 Ga0265325_10000103 3300031241 Bacteria 59918
29 Ga0265325_10109050 3300031241 Bacteria 1347
30 Ga0265339_10007323 3300031249 Bacteria 7147
31 Ga0265331_10000817 3300031250 Bacteria 25705
32 Ga0265316_10382181 3300031344 Bacteria 1016
33 Ga0265313_10003607 3300031595 Bacteria 12431
34 Ga0265314_10000383 3300031711 Bacteria 60688
35 Ga0265342_10008483 3300031712 Bacteria 7362
36 Ga0307405_10186680 3300031731 Bacteria 1493
37 Ga0307405_10257102 3300031731 Bacteria 1302
38 Ga0307410_10295131 3300031852 Bacteria 1277
39 Ga0307412_10447723 3300031911 Bacteria 1063
40 Ga0307409_100252344 3300031995 Bacteria 1614
41 Ga0307416_100631430 3300032002 Bacteria 1154
42 Ga0307416_100750904 3300032002 Bacteria 1068
43 Ga0307415_100426007 3300032126 Bacteria 1140
44 Ga0316593_10003796 3300032168 Bacteria 3797
45 Ga0316593_10004084 3300032168 Bacteria 3704
46 Ga0316593_10032669 3300032168 Bacteria 1701
47 Ga0316593_10064864 3300032168 Bacteria 1254
48 Ga0316593_10098074 3300032168 Bacteria 1037
49 Ga0316596_1030057 3300033541 Bacteria 1408
50 Ga0316574_0040156 3300035398 Bacteria 2880
51 Ga0436364_0129605 3300037853 Bacteria 3589
52 Ga0436364_0260898 3300037853 Bacteria 3353
53 Ga0436364_0568777 3300037853 Bacteria 8759
54 Ga0436364_1154304 3300037853 Bacteria 15815
55 Ga0436365_0253568 3300039437 Bacteria 8998
56 Ga0436363_0289477 3300039450 Bacteria 974
57 Ga0436363_0607683 3300039450 Bacteria 6288
58 Ga0436363_0884579 3300039450 Bacteria 1696
59 Ga0436363_1123012 3300039450 Bacteria 1437
60 Ga0451793_1111286 3300041452 Bacteria 1558
61 Ga0466968_0018279 3300044735 Bacteria 2811
62 Ga0466957_0110938 3300044842 Bacteria 1739
63 Ga0466967_0134224 3300045976 Bacteria 2301
64 Ga0466967_0345127 3300045976 Bacteria 1440
65 Ga0466967_0411301 3300045976 Bacteria 1317
66 Ga0495657_0347931 3300046675 Bacteria 877
67 Ga0496104_0028997 3300048907 Bacteria 5132
68 Ga0496107_0148264 3300048910 Bacteria 1735
69 Ga0496109_0105791 3300048912 Bacteria 2613
70 Ga0496113_0243243 3300048916 Bacteria 1436
71 Ga0496115_0084549 3300048918 Bacteria 2587
72 Ga0496122_0001347 3300048925 Bacteria 40068
73 Ga0501034_0005830 3300049571 Bacteria 13399
74 Ga0501034_0009233 3300049571 Bacteria 10337
75 Ga0501034_0012995 3300049571 Bacteria 8583
76 Ga0501034_0031722 3300049571 Bacteria 5367
77 Ga0501034_0132524 3300049571 Bacteria 2475
78 Ga0501034_0355333 3300049571 Bacteria 1393
79 Ga0501034_0535051 3300049571 Bacteria 1082
80 Ga0501039_0123039 3300049575 Bacteria 2034
81 Ga0501043_0081903 3300049579 Bacteria 2536
82 Ga0501043_0095506 3300049579 Bacteria 2336
83 Ga0501046_0198015 3300049580 Bacteria 1495
84 Ga0501047_0077145 3300049581 Bacteria 3206
85 Ga0501070_0058426 3300049586 Bacteria 3197
86 Ga0501073_0575855 3300049589 Bacteria 778
87 Ga0501074_0122283 3300049590 Bacteria 1862
88 Ga0501075_0474697 3300049591 Bacteria 954
89 Ga0501079_0281984 3300049741 Bacteria 1299
90 Ga0501080_0129827 3300049742 Bacteria 2333
91 Ga0501083_0393889 3300049744 Bacteria 901
92 Ga0501044_0013478 3300049823 Bacteria 8842
93 Ga0501044_0034649 3300049823 Bacteria 5293
94 Ga0501044_0064152 3300049823 Bacteria 3751
95 Ga0501044_0114295 3300049823 Bacteria 2705
96 Ga0501045_0326188 3300049824 Bacteria 1142
97 Ga0501045_0517569 3300049824 Bacteria 886
98 Ga0501045_0682206 3300049824 Bacteria 758
99 nmdc:mga0yw44_104046_c1 3300050492 Bacteria 1811
100 nmdc:mga0yw44_93917_c2 3300050492 Bacteria 973
101 nmdc:mga06r32_301424_c1 3300050510 Bacteria 1588
102 nmdc:mga08y16_422297_c1 3300050511 Bacteria 1362
103 nmdc:mga08y16_524799_c1 3300050511 Bacteria 1200
104 Ga0495601_0176132 3300053077 Bacteria 1398
105 Ga0500610_0185872 3300053079 Bacteria 1013
106 Ga0500592_000173 3300053116 Bacteria 12743
107 Ga0587077_038367 3300059493 Bacteria 949
108 Ga0587080_016613 3300059503 Bacteria 1164
109 Ga0587072_005086 3300059643 Bacteria 1948
110 2687239070 2684623219 Bacteria 8442773
111 2688396272 2687453341 Bacteria 6534136
112 2852645428 2852643534 Bacteria 3013378
113 2857735629 2857733635 Bacteria 3532004
114 Ga0501047_0179092
115 Ga0065712_10069143
116 Ga0065707_10007864
117 Ga0070682_100394498
118 Ga0070667_100149357
119 Ga0070714_100356261
120 Ga0070665_100000481
121 Ga0068858_100005610
122 Ga0081455_10113798
123 Ga0075365_10078373
124 Ga0105245_10431968
125 Ga0114129_11301495
126 Ga0105249_10526930
127 Ga0105239_10125758
128 Ga0105239_10702429
129 Ga0206356_10810780
130 Ga0213874_10031674
131 Ga0213874_10048144
132 Ga0213874_10067524
133 Ga0213875_10009009
134 Ga0213875_10025006
135 Ga0207669_10582861
136 Ga0207711_10437023
137 Ga0207683_10203714
138 Ga0268266_10000486
139 Ga0268266_10000579
140 Ga0265760_10016877
141 Ga0265325_10000103
142 Ga0265325_10109050
143 Ga0265339_10007323
144 Ga0265331_10000817
145 Ga0265316_10382181
146 Ga0265313_10003607
147 Ga0265314_10000383
148 Ga0265342_10008483
149 Ga0307405_10186680
150 Ga0307405_10257102
151 Ga0307410_10295131
152 Ga0307412_10447723
153 Ga0307409_100252344
154 Ga0307416_100631430
155 Ga0307416_100750904
156 Ga0307415_100426007
157 Ga0316593_10003796
158 Ga0316593_10004084
159 Ga0316593_10032669
160 Ga0316593_10064864
161 Ga0316593_10098074
162 Ga0316596_1030057
163 Ga0316574_0040156
164 Ga0436364_0129605
165 Ga0436364_0260898
166 Ga0436364_0568777
167 Ga0436364_1154304
168 Ga0436365_0253568
169 Ga0436363_0289477
170 Ga0436363_0607683
171 Ga0436363_0884579
172 Ga0436363_1123012
173 Ga0451793_1111286
174 Ga0466968_0018279
175 Ga0466957_0110938
176 Ga0466967_0134224
177 Ga0466967_0345127
178 Ga0466967_0411301
179 Ga0495657_0347931
180 Ga0496104_0028997
181 Ga0496107_0148264
182 Ga0496109_0105791
183 Ga0496113_0243243
184 Ga0496115_0084549
185 Ga0496122_0001347
186 Ga0501034_0005830
187 Ga0501034_0009233
188 Ga0501034_0012995
189 Ga0501034_0031722
190 Ga0501034_0132524
191 Ga0501034_0355333
192 Ga0501034_0535051
193 Ga0501039_0123039
194 Ga0501043_0081903
195 Ga0501043_0095506
196 Ga0501046_0198015
197 Ga0501047_0077145
198 Ga0501070_0058426
199 Ga0501073_0575855
200 Ga0501074_0122283
201 Ga0501075_0474697
202 Ga0501079_0281984
203 Ga0501080_0129827
204 Ga0501083_0393889
205 Ga0501044_0013478
206 Ga0501044_0034649
207 Ga0501044_0064152
208 Ga0501044_0114295
209 Ga0501045_0326188
210 Ga0501045_0517569
211 Ga0501045_0682206
212 nmdc:mga0yw44_104046_c1
213 nmdc:mga0yw44_93917_c2
214 nmdc:mga06r32_301424_c1
215 nmdc:mga08y16_422297_c1
216 nmdc:mga08y16_524799_c1
217 Ga0495601_0176132
218 Ga0500610_0185872
219 Ga0500592_000173
220 Ga0587077_038367
221 Ga0587080_016613
222 Ga0587072_005086
223 2687239070
224 2688396272
225 2852645428
226 2857735629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

41

201

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5awf-assembly1.cif.gz_D crystal structure of sufb-sufc-sufd complex from escherichia coli 0.9282 5 236
2zu0-assembly1.cif.gz_C crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis 0.9111 5 247
2d2e-assembly1.cif.gz_A crystal structure of atypical cytoplasmic abc-atpase sufc from thermus thermophilus hb8 0.9036 4 252
2d2f-assembly1.cif.gz_A crystal structure of atypical cytoplasmic abc-atpase sufc from thermus thermophilus hb8 0.903 4 253
5awf-assembly1.cif.gz_D crystal structure of sufb-sufc-sufd complex from escherichia coli 0.9018 5 236
ID Description Score Start End Superfamily
af_Q2FZY7_2_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9486 3 255 3.40.50.300
af_Q2FZY7_2_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.934 3 255 3.40.50.300
af_Q8ILW0_99_346_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9044 5 249 3.40.50.300
af_Q8ILW0_99_346_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8872 5 249 3.40.50.300
af_Q60350_5_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8764 5 250 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A351MIF7-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.9651 1 242 GO:0005524
GO:0016887
AF-A0A537HGZ3-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.9565 1 253 GO:0005524
GO:0016887
AF-A0A4R0ZMB4-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.9466 6 255 GO:0005524
GO:0016887
AF-A0A3C0R3B9-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.946 3 160 GO:0005524
GO:0016887
AF-B0N6P2-F1-model_v4 FeS assembly ATPase SufC 0.9455 1 252 GO:0005524
GO:0016020
GO:0016887

Map