F075144

General Info

Members Datasets Scaffolds Average Seq Length
113 85 226 346

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0000045|Ga0451577_0000045_195398_196594
Length 398
Sequence MRFYRQLKRLECLRIGFIKMILKAFIVDDTVIYRKILTDAISSFSNVTISGTAPSGEIALKKIALDKPDIVFLDVHMPGMNGIETLKHIKLTYPEMAVVMVSGISSHSTGDTIEALQLGAIDFIRKPDGNDMRKNTELLHNDINSVLRFFELKMRTRVIQNVSANNKIENVTPKNDISPFPASGDDTSSKTYSAKLPQTFSIVAIGVSTGGPEALSKLIPRIPEDFPLPIVVVQHMPPLFTKSLADSLTRRSKVKVVEAGENILLAKGTVYIAPGGNHLVVRNANNSMVTGINDGPPENSCRPSVDVLFRSVAAHYGDNGVLAVILTGMGNDGLNGVRTLKRKKCLCLTQSEQSCVVYGMPRAIDEAGLSDKSLPIDLIADEIVSLVYKKNVVPEIAV

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
17 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
46 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
47 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
48 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
50 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
51 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
54 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
55 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
56 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
57 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
58 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
59 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
60 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
61 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
62 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
76 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
77 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
78 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
79 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
80 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
81 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
82 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
83 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
84 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
85 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 0.88
Isolates 1.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 0.88
Rhizosphere 90.27
Stem 0
Stem Tuber 0
Unclassified 9.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0000045 3300042876 Bacteria 325195
2 rootH1_10041030 3300003323 Bacteria 7982
3 Ga0065707_10184059 3300005295 Bacteria 1393
4 Ga0070683_100433024 3300005329 Unclassified 1255
5 Ga0068868_100200118 3300005338 Unclassified 1665
6 Ga0070674_100020714 3300005356 Bacteria 4208
7 Ga0070673_100005663 3300005364 Bacteria 8026
8 Ga0070701_10007107 3300005438 Bacteria 4756
9 Ga0070700_100044036 3300005441 Bacteria 2747
10 Ga0070678_100159834 3300005456 Bacteria 1824
11 Ga0070681_10023601 3300005458 Bacteria 6187
12 Ga0070704_100091067 3300005549 Bacteria 2273
13 Ga0070664_100147139 3300005564 Bacteria 2078
14 Ga0068858_100090848 3300005842 Bacteria 2842
15 Ga0097621_100016951 3300006237 Bacteria 5522
16 Ga0068871_100042004 3300006358 Bacteria 3669
17 Ga0068865_100045724 3300006881 Bacteria 3002
18 Ga0105244_10011348 3300009036 Bacteria 5352
19 Ga0111539_10002386 3300009094 Bacteria 24942
20 Ga0105247_10007379 3300009101 Bacteria 6752
21 Ga0105242_10299710 3300009176 Unclassified 1467
22 Ga0105248_10038489 3300009177 Bacteria 5352
23 Ga0105249_10332198 3300009553 Bacteria 1534
24 Ga0105239_10009716 3300010375 Bacteria 10815
25 Ga0157378_10312627 3300013297 Unclassified 1524
26 Ga0163162_10086571 3300013306 Bacteria 3211
27 Ga0163163_10076371 3300014325 Bacteria 3344
28 Ga0157380_10101105 3300014326 Bacteria 2402
29 Ga0157380_10224901 3300014326 Bacteria 1681
30 Ga0207655_1000138 3300025728 Bacteria 140079
31 Ga0207710_10003057 3300025900 Bacteria 7519
32 Ga0207707_10012712 3300025912 Bacteria 7318
33 Ga0207681_10326431 3300025923 Bacteria 1222
34 Ga0207686_10104544 3300025934 Bacteria 1897
35 Ga0207686_10151734 3300025934 Bacteria 1614
36 Ga0207686_10187715 3300025934 Unclassified 1471
37 Ga0207709_10057419 3300025935 Bacteria 2413
38 Ga0207704_10021269 3300025938 Bacteria 3451
39 Ga0207711_10021574 3300025941 Bacteria 5379
40 Ga0207711_10043697 3300025941 Bacteria 3824
41 Ga0207661_10404057 3300025944 Bacteria 1239
42 Ga0207651_10100524 3300025960 Bacteria 2144
43 Ga0207712_10274564 3300025961 Bacteria 1373
44 Ga0207658_10108395 3300025986 Bacteria 2191
45 Ga0207683_10119713 3300026121 Bacteria 2362
46 Ga0207428_10050094 3300027907 Bacteria 3342
47 Ga0268264_10166928 3300028381 Bacteria 1988
48 Ga0265324_10000016 3300029957 Bacteria 187847
49 Ga0265316_10050572 3300031344 Bacteria 3268
50 Ga0316575_10000030 3300031665 Bacteria 34472
51 Ga0316576_10095592 3300031727 Bacteria 2217
52 Ga0316587_1000092 3300033529 Bacteria 6408
53 Ga0316212_1002884 3300033547 Bacteria 2467
54 Ga0373933_0084369 3300035724 Bacteria 1952
55 Ga0373937_0063294 3300036401 Unclassified 3402
56 Ga0373937_0303652 3300036401 Unclassified 1509
57 Ga0436365_0138064 3300039437 Bacteria 2734
58 Ga0436365_0267071 3300039437 Bacteria 10302
59 Ga0436365_0882949 3300039437 Bacteria 4814
60 Ga0436365_0932108 3300039437 Bacteria 1522
61 Ga0436363_1046466 3300039450 Unclassified 1460
62 Ga0451577_0008753 3300042876 Bacteria 9811
63 Ga0453683_0010923 3300044673 Bacteria 6004
64 Ga0453684_0000131 3300044712 Bacteria 331521
65 Ga0453684_0000247 3300044712 Bacteria 233307
66 Ga0453684_0003846 3300044712 Bacteria 33078
67 Ga0453684_0003892 3300044712 Bacteria 32817
68 Ga0453684_0006453 3300044712 Bacteria 22266
69 Ga0453684_0006848 3300044712 Bacteria 21413
70 Ga0453684_0007560 3300044712 Bacteria 19925
71 Ga0453684_0072812 3300044712 Bacteria 4335
72 Ga0451576_0000328 3300045051 Bacteria 114969
73 Ga0451576_0129777 3300045051 Bacteria 2627
74 Ga0451576_0360804 3300045051 Bacteria 1522
75 Ga0495644_0012526 3300046523 Bacteria 3261
76 Ga0495659_0000199 3300046664 Bacteria 25838
77 Ga0495599_0045899 3300046678 Unclassified 2740
78 Ga0495626_0061042 3300048091 Bacteria 1716
79 Ga0496109_0178977 3300048912 Bacteria 1991
80 Ga0501031_0003075 3300049568 Bacteria 10666
81 Ga0501031_0008202 3300049568 Bacteria 6797
82 Ga0501032_0032588 3300049569 Bacteria 3571
83 Ga0501032_0047473 3300049569 Bacteria 2899
84 Ga0501033_0076262 3300049570 Bacteria 2461
85 Ga0501034_0195199 3300049571 Bacteria 1985
86 Ga0501034_0242036 3300049571 Bacteria 1750
87 Ga0501034_0297334 3300049571 Unclassified 1552
88 Ga0501036_0005185 3300049572 Bacteria 10539
89 Ga0501036_0140385 3300049572 Bacteria 2039
90 Ga0501037_0009647 3300049573 Bacteria 7084
91 Ga0501038_0080868 3300049574 Bacteria 2738
92 Ga0501039_0002209 3300049575 Bacteria 14400
93 Ga0501039_0008438 3300049575 Bacteria 7851
94 Ga0501041_0004636 3300049577 Bacteria 7976
95 Ga0501042_0005263 3300049578 Bacteria 8314
96 Ga0501042_0057122 3300049578 Bacteria 2785
97 Ga0501043_0056743 3300049579 Bacteria 3076
98 Ga0501046_0001409 3300049580 Bacteria 23145
99 Ga0501046_0006959 3300049580 Bacteria 9966
100 Ga0501048_0092520 3300049582 Bacteria 2132
101 Ga0501070_0003728 3300049586 Bacteria 13151
102 Ga0501070_0016198 3300049586 Bacteria 6263
103 Ga0501071_0026596 3300049587 Bacteria 4063
104 Ga0501080_0253648 3300049742 Unclassified 1604
105 Ga0501083_0116312 3300049744 Bacteria 1755
106 Ga0501035_0055957 3300049822 Bacteria 3521
107 nmdc:mga08y16_3654_c1 3300050511 Bacteria 15998
108 nmdc:mga0a205_239311_c1 3300050515 Bacteria 1696
109 Ga0500608_000178 3300053122 Bacteria 25999
110 Ga0501082_0140131 3300060353 Bacteria 2099
111 Ga0501082_0280264 3300060353 Bacteria 1451
112 2990278939 2990275345 Bacteria 4887158
113 3006828782 3006826541 Bacteria 4678913
114 Ga0451577_0000045
115 rootH1_10041030
116 Ga0065707_10184059
117 Ga0070683_100433024
118 Ga0068868_100200118
119 Ga0070674_100020714
120 Ga0070673_100005663
121 Ga0070701_10007107
122 Ga0070700_100044036
123 Ga0070678_100159834
124 Ga0070681_10023601
125 Ga0070704_100091067
126 Ga0070664_100147139
127 Ga0068858_100090848
128 Ga0097621_100016951
129 Ga0068871_100042004
130 Ga0068865_100045724
131 Ga0105244_10011348
132 Ga0111539_10002386
133 Ga0105247_10007379
134 Ga0105242_10299710
135 Ga0105248_10038489
136 Ga0105249_10332198
137 Ga0105239_10009716
138 Ga0157378_10312627
139 Ga0163162_10086571
140 Ga0163163_10076371
141 Ga0157380_10101105
142 Ga0157380_10224901
143 Ga0207655_1000138
144 Ga0207710_10003057
145 Ga0207707_10012712
146 Ga0207681_10326431
147 Ga0207686_10104544
148 Ga0207686_10151734
149 Ga0207686_10187715
150 Ga0207709_10057419
151 Ga0207704_10021269
152 Ga0207711_10021574
153 Ga0207711_10043697
154 Ga0207661_10404057
155 Ga0207651_10100524
156 Ga0207712_10274564
157 Ga0207658_10108395
158 Ga0207683_10119713
159 Ga0207428_10050094
160 Ga0268264_10166928
161 Ga0265324_10000016
162 Ga0265316_10050572
163 Ga0316575_10000030
164 Ga0316576_10095592
165 Ga0316587_1000092
166 Ga0316212_1002884
167 Ga0373933_0084369
168 Ga0373937_0063294
169 Ga0373937_0303652
170 Ga0436365_0138064
171 Ga0436365_0267071
172 Ga0436365_0882949
173 Ga0436365_0932108
174 Ga0436363_1046466
175 Ga0451577_0008753
176 Ga0453683_0010923
177 Ga0453684_0000131
178 Ga0453684_0000247
179 Ga0453684_0003846
180 Ga0453684_0003892
181 Ga0453684_0006453
182 Ga0453684_0006848
183 Ga0453684_0007560
184 Ga0453684_0072812
185 Ga0451576_0000328
186 Ga0451576_0129777
187 Ga0451576_0360804
188 Ga0495644_0012526
189 Ga0495659_0000199
190 Ga0495599_0045899
191 Ga0495626_0061042
192 Ga0496109_0178977
193 Ga0501031_0003075
194 Ga0501031_0008202
195 Ga0501032_0032588
196 Ga0501032_0047473
197 Ga0501033_0076262
198 Ga0501034_0195199
199 Ga0501034_0242036
200 Ga0501034_0297334
201 Ga0501036_0005185
202 Ga0501036_0140385
203 Ga0501037_0009647
204 Ga0501038_0080868
205 Ga0501039_0002209
206 Ga0501039_0008438
207 Ga0501041_0004636
208 Ga0501042_0005263
209 Ga0501042_0057122
210 Ga0501043_0056743
211 Ga0501046_0001409
212 Ga0501046_0006959
213 Ga0501048_0092520
214 Ga0501070_0003728
215 Ga0501070_0016198
216 Ga0501071_0026596
217 Ga0501080_0253648
218 Ga0501083_0116312
219 Ga0501035_0055957
220 nmdc:mga08y16_3654_c1
221 nmdc:mga0a205_239311_c1
222 Ga0500608_000178
223 Ga0501082_0140131
224 Ga0501082_0280264
225 2990278939
226 3006828782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01339

CheB_methylest

CheB methylesterase

203

383

0.96

PF00072

Response_reg

Response regulator receiver domain

24

137

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sft-assembly1.cif.gz_A crystal structure of thermotoga maritima cheb methylesterase catalytic domain 0.972 152 339
1chd-assembly1.cif.gz_A cheb methylesterase domain 0.9694 152 336
3sft-assembly1.cif.gz_A crystal structure of thermotoga maritima cheb methylesterase catalytic domain 0.962 152 339
6ymz-assembly3.cif.gz_C structure of the cheb methylsterase from p. atrosepticum scri1043 0.9484 1 338
6ymz-assembly4.cif.gz_D structure of the cheb methylsterase from p. atrosepticum scri1043 0.943 1 338
ID Description Score Start End Superfamily
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.972 152 339 3.40.50.180
af_P07330_147_349_3.40.50.180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9671 144 337 3.40.50.180
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.962 152 339 3.40.50.180
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9282 1 81 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.921 5 81 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7C7U9T4-F1-model_v4 Response regulator 0.9934 2 72 GO:0000160
AF-A0A7C7W1A3-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9803 182 337 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A2V8WZ37-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9803 266 337 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A3N5XFV7-F1-model_v4 deleted 0.9784 253 337
AF-A0A381EZK3-F1-model_v4 deleted 0.9747 259 337

Map