F074567

General Info

Members Datasets Scaffolds Average Seq Length
113 100 226 124

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10001149|Ga0265327_1000114912
Length 143
Sequence MTFLEWLFGRNKANYVDRRKRVFISFAIEDEKFRTFLVGQSKSHNSPFEFIDMSVKEAWDEDEWKKRCRTKIKRCHGAIVLLSKNTYHSSGVRYEVKCAIEEGIPIVGMHIKKGDKGAILPELMNKKVINWTWNSIEKFINTL

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
30 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
31 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
32 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
33 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
44 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
51 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
52 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
53 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
54 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
55 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
56 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
57 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
58 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
59 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
60 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
61 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
62 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
63 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
64 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
65 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
66 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
69 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
70 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
71 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
72 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
73 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
74 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
75 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
76 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
77 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
78 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
79 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
80 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
81 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
82 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
83 2501939600 Micromonospora sp. L5 Isolate Unclassified
84 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
85 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
86 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
87 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
88 2643221568 Rhizobium sp. Root564 Isolate Unclassified
89 2791355266 Rhizobium sp. L43 Isolate Nodule
90 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
91 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
92 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
93 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
94 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
95 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
96 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
97 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
98 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
99 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
100 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.19
Metatranscriptomes 0.88
Isolates 15.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.08
Nodule 13.27
Rhizoplane 1.77
Rhizosphere 68.14
Stem 0
Stem Tuber 0
Unclassified 13.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10001149 3300031251 Bacteria 36094
2 JGI24739J22299_10098346 3300001989 Unclassified 885
3 JGI25156J39149_1000762 3300002705 Bacteria 16732
4 Ga0006562J51391_1006507 3300003578 Bacteria 4885
5 Ga0065704_10748470 3300005289 Unclassified 543
6 Ga0070658_10404280 3300005327 Bacteria 1173
7 Ga0070680_100029023 3300005336 Bacteria 4442
8 Ga0070680_100305014 3300005336 Unclassified 1350
9 Ga0070681_10013805 3300005458 Bacteria 8040
10 Ga0070706_100339640 3300005467 Unclassified 1400
11 Ga0070698_101743478 3300005471 Bacteria 575
12 Ga0070679_100026099 3300005530 Bacteria 5735
13 Ga0068855_100170019 3300005563 Bacteria 2469
14 Ga0068855_100526179 3300005563 Bacteria 1282
15 Ga0068856_101041123 3300005614 Bacteria 836
16 Ga0068852_101427458 3300005616 Unclassified 714
17 Ga0068863_101005958 3300005841 Unclassified 836
18 Ga0068860_100089290 3300005843 Bacteria 2934
19 Ga0070717_10000395 3300006028 Bacteria 27918
20 Ga0070717_10774802 3300006028 Bacteria 872
21 Ga0068865_101122362 3300006881 Bacteria 693
22 Ga0105240_10018102 3300009093 Bacteria 9473
23 Ga0105240_10043909 3300009093 Bacteria 5684
24 Ga0105248_10000914 3300009177 Bacteria 32840
25 Ga0105237_11361223 3300009545 Unclassified 716
26 Ga0105249_10379821 3300009553 Bacteria 1438
27 Ga0105028_128413 3300009993 Bacteria 621
28 Ga0157371_10004656 3300013102 Bacteria 11878
29 Ga0157370_10093245 3300013104 Bacteria 2826
30 Ga0157369_10243362 3300013105 Bacteria 1878
31 Ga0157372_10020770 3300013307 Bacteria 7091
32 Ga0157372_12287859 3300013307 Bacteria 621
33 Ga0157372_12721229 3300013307 Unclassified 567
34 Ga0182008_10003120 3300014497 Bacteria 10144
35 Ga0182008_10014792 3300014497 Bacteria 4081
36 Ga0182006_1048570 3300015261 Unclassified 1641
37 Ga0182006_1048774 3300015261 Bacteria 1636
38 Ga0182007_10000829 3300015262 Bacteria 17195
39 Ga0182007_10012210 3300015262 Bacteria 3313
40 Ga0228711_1011162 3300022739 Bacteria 11526
41 Ga0228710_1004851 3300022740 Bacteria 21107
42 Ga0207707_10008839 3300025912 Bacteria 8747
43 Ga0207707_10754460 3300025912 Unclassified 813
44 Ga0207695_10032080 3300025913 Bacteria 5753
45 Ga0207695_10368098 3300025913 Bacteria 1323
46 Ga0207660_10064502 3300025917 Bacteria 2644
47 Ga0207652_10007895 3300025921 Bacteria 8540
48 Ga0207704_11759388 3300025938 Bacteria 533
49 Ga0207667_10139840 3300025949 Bacteria 2493
50 Ga0207667_10731598 3300025949 Bacteria 990
51 Ga0207712_10672439 3300025961 Bacteria 901
52 Ga0207702_10654291 3300026078 Bacteria 1033
53 Ga0207698_11253561 3300026142 Unclassified 756
54 Ga0268264_10113718 3300028381 Bacteria 2375
55 Ga0307513_10252312 3300031456 Bacteria 1560
56 Ga0307413_10000415 3300031824 Bacteria 13755
57 Ga0307410_10006040 3300031852 Bacteria 6490
58 Ga0307407_10139408 3300031903 Bacteria 1562
59 Ga0307409_100002554 3300031995 Bacteria 9554
60 Ga0307414_12124893 3300032004 Unclassified 524
61 Ga0307411_10019338 3300032005 Bacteria 3932
62 Ga0373950_0000100 3300034818 Bacteria 21353
63 Ga0439447_001398 3300041407 Bacteria 8844
64 Ga0451833_0455748 3300041491 Bacteria 1772
65 Ga0451837_1190766 3300041494 Bacteria 894
66 Ga0451841_0181508 3300041498 Bacteria 1185
67 Ga0451851_0020316 3300041507 Bacteria 1077
68 Ga0451853_1803198 3300041512 Bacteria 1118
69 Ga0451853_3391234 3300041512 Bacteria 4454
70 Ga0495590_0035815 3300046457 Bacteria 1732
71 Ga0495584_0001126 3300046491 Bacteria 16567
72 Ga0495606_0080865 3300046507 Bacteria 2021
73 Ga0495610_0005277 3300046512 Bacteria 9243
74 Ga0495671_0183148 3300046692 Bacteria 1017
75 Ga0495676_0014127 3300047321 Bacteria 7151
76 Ga0495679_001791 3300047446 Bacteria 11730
77 Ga0495602_0016944 3300048088 Bacteria 7312
78 Ga0501298_066762 3300049521 Bacteria 770
79 Ga0501038_0270840 3300049574 Bacteria 1339
80 Ga0501047_0038951 3300049581 Plasmid 4598
81 Ga0501070_0024825 3300049586 Bacteria 5027
82 Ga0501073_0157290 3300049589 Bacteria 1575
83 Ga0501202_018281 3300049652 Bacteria 1375
84 Ga0501235_122865 3300049669 Unclassified 651
85 Ga0501238_035749 3300049671 Bacteria 724
86 Ga0501247_015902 3300049677 Bacteria 943
87 Ga0501264_000071 3300049761 Bacteria 14565
88 Ga0500610_0044460 3300053079 Bacteria 2304
89 Ga0500556_0224311 3300053104 Unclassified 741
90 Ga0500572_001867 3300053111 Bacteria 5334
91 Ga0500593_000339 3300053117 Bacteria 18810
92 Ga0500622_0003485 3300053156 Bacteria 10455
93 Ga0500634_0298640 3300053161 Unclassified 640
94 Ga0500637_0187474 3300053178 Bacteria 1183
95 Ga0500596_004410 3300053735 Bacteria 2580
96 2501941563 2501939600 Bacteria 6907073
97 2509152852 2508501128 Bacteria 8613869
98 2585558103 2585427531 Bacteria 6992870
99 2599480939 2599185184 Bacteria 6430550
100 2600191348 2599185352 Bacteria 7228948
101 2643853630 2643221568 Bacteria 5187270
102 2793364449 2791355266 Bacteria 7116587
103 2805931502 2802429605 Bacteria 6875453
104 2805938339 2802429606 Bacteria 6346811
105 2842290637 2842285085 Bacteria 6011953
106 2842408482 2842402390 Bacteria 6681310
107 2842414582 2842409023 Bacteria 6687331
108 2842421840 2842415677 Bacteria 6596907
109 2935819140 2935810662 Bacteria 9401221
110 2935885503 2935883170 Bacteria 7964738
111 2936045709 2936037263 Bacteria 9446081
112 8016613417 8016613128 Bacteria 8794220
113 8057880216 8057874678 Bacteria 7494653
114 Ga0265327_10001149
115 JGI24739J22299_10098346
116 JGI25156J39149_1000762
117 Ga0006562J51391_1006507
118 Ga0065704_10748470
119 Ga0070658_10404280
120 Ga0070680_100029023
121 Ga0070680_100305014
122 Ga0070681_10013805
123 Ga0070706_100339640
124 Ga0070698_101743478
125 Ga0070679_100026099
126 Ga0068855_100170019
127 Ga0068855_100526179
128 Ga0068856_101041123
129 Ga0068852_101427458
130 Ga0068863_101005958
131 Ga0068860_100089290
132 Ga0070717_10000395
133 Ga0070717_10774802
134 Ga0068865_101122362
135 Ga0105240_10018102
136 Ga0105240_10043909
137 Ga0105248_10000914
138 Ga0105237_11361223
139 Ga0105249_10379821
140 Ga0105028_128413
141 Ga0157371_10004656
142 Ga0157370_10093245
143 Ga0157369_10243362
144 Ga0157372_10020770
145 Ga0157372_12287859
146 Ga0157372_12721229
147 Ga0182008_10003120
148 Ga0182008_10014792
149 Ga0182006_1048570
150 Ga0182006_1048774
151 Ga0182007_10000829
152 Ga0182007_10012210
153 Ga0228711_1011162
154 Ga0228710_1004851
155 Ga0207707_10008839
156 Ga0207707_10754460
157 Ga0207695_10032080
158 Ga0207695_10368098
159 Ga0207660_10064502
160 Ga0207652_10007895
161 Ga0207704_11759388
162 Ga0207667_10139840
163 Ga0207667_10731598
164 Ga0207712_10672439
165 Ga0207702_10654291
166 Ga0207698_11253561
167 Ga0268264_10113718
168 Ga0307513_10252312
169 Ga0307413_10000415
170 Ga0307410_10006040
171 Ga0307407_10139408
172 Ga0307409_100002554
173 Ga0307414_12124893
174 Ga0307411_10019338
175 Ga0373950_0000100
176 Ga0439447_001398
177 Ga0451833_0455748
178 Ga0451837_1190766
179 Ga0451841_0181508
180 Ga0451851_0020316
181 Ga0451853_1803198
182 Ga0451853_3391234
183 Ga0495590_0035815
184 Ga0495584_0001126
185 Ga0495606_0080865
186 Ga0495610_0005277
187 Ga0495671_0183148
188 Ga0495676_0014127
189 Ga0495679_001791
190 Ga0495602_0016944
191 Ga0501298_066762
192 Ga0501038_0270840
193 Ga0501047_0038951
194 Ga0501070_0024825
195 Ga0501073_0157290
196 Ga0501202_018281
197 Ga0501235_122865
198 Ga0501238_035749
199 Ga0501247_015902
200 Ga0501264_000071
201 Ga0500610_0044460
202 Ga0500556_0224311
203 Ga0500572_001867
204 Ga0500593_000339
205 Ga0500622_0003485
206 Ga0500634_0298640
207 Ga0500637_0187474
208 Ga0500596_004410
209 2501941563
210 2509152852
211 2585558103
212 2599480939
213 2600191348
214 2643853630
215 2793364449
216 2805931502
217 2805938339
218 2842290637
219 2842408482
220 2842414582
221 2842421840
222 2935819140
223 2935885503
224 2936045709
225 8016613417
226 8057880216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08937

ThsB_TIR

Thoeris protein ThsB, TIR-like domain

23

116

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7osa-assembly1.cif.gz_eEF2 pre-translocation complex of 80 s.cerevisiae ribosome with eef2 and ligands 0.7485 33 94
6lhy-assembly2.cif.gz_B crystal structure of thsb 0.7478 5 101
7l6w-assembly1.cif.gz_A sfx structure of the myd88 tir domain higher-order assembly 0.7378 7 119
7jlx-assembly1.cif.gz_D structure of the activated roq1 resistosome directly recognizing the pathogen effector xopq (tir domains) 0.7344 4 94
6lhy-assembly1.cif.gz_A crystal structure of thsb 0.7318 5 101
ID Description Score Start End Superfamily
af_K7KXK7_109_266_3.40.50.10140 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Toll/interleukin-1 receptor homology (TIR) domain 0.8126 4 94 3.40.50.10140
af_Q9SYC9_354_519_3.40.50.10140 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Toll/interleukin-1 receptor homology (TIR) domain 0.7911 1 92 3.40.50.10140
af_K7M4Z6_13_182_3.40.50.10140 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Toll/interleukin-1 receptor homology (TIR) domain 0.7805 7 94 3.40.50.10140
af_K7L9P4_20_181_3.40.50.10140 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Toll/interleukin-1 receptor homology (TIR) domain 0.7747 5 94 3.40.50.10140
af_I1MEE1_4_136_3.40.50.10140 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Toll/interleukin-1 receptor homology (TIR) domain 0.7716 5 101 3.40.50.10140
ID Description Score Start End GO Terms
AF-A0A2W6R4C9-F1-model_v4 deleted 0.9959 46 123
AF-A0A2W6R4C9-F1-model_v4 deleted 0.9711 46 123
AF-A0A0M7BZU7-F1-model_v4 Thoeris protein ThsB TIR-like domain-containing protein 0.9453 1 123
AF-A0A8A7AWI0-F1-model_v4 deleted 0.9439 2 123
AF-A0A0M7BZU7-F1-model_v4 Thoeris protein ThsB TIR-like domain-containing protein 0.9379 1 123

Map