F073898

General Info

Members Datasets Scaffolds Average Seq Length
113 84 226 215

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10146366|Ga0157370_101463663
Length 231
Sequence MQPTERAHGLILRTRPFTETSLIVNWLTPEFGRVSTVAKGARRSKSPFRGKLDLFYEADFSFQRSRRSELHTLREMVLRETNTALRHELGYLQQASYCATLVEQTTETQTPLPEIYELFFGFIHALPKYPPRPRTIFAFELKLLQALGLSPDVPDSKLPADARALVNSLMETGWENLGNLRATAAQARSVKQFLHGFLIFHLGKIPRGREQAVGAISEYTARREGPIRKPY

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
67 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
72 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
73 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
74 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
75 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
76 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
79 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
83 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
84 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.12
Stem 0
Stem Tuber 0
Unclassified 35.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10146366 3300013104 Unclassified 2200
2 rootH1_10227244 3300003323 Bacteria 1407
3 Ga0070683_100921544 3300005329 Unclassified 838
4 Ga0070677_10071527 3300005333 Bacteria 1460
5 Ga0068869_100186910 3300005334 Bacteria 1627
6 Ga0070680_100771191 3300005336 Bacteria 828
7 Ga0070660_100520122 3300005339 Bacteria 991
8 Ga0070689_100089683 3300005340 Bacteria 2422
9 Ga0070689_100147315 3300005340 Bacteria 1897
10 Ga0070689_100454076 3300005340 Bacteria 1091
11 Ga0070668_100248064 3300005347 Bacteria 1477
12 Ga0070675_100084514 3300005354 Bacteria 2651
13 Ga0070688_100140753 3300005365 Unclassified 1638
14 Ga0070667_100535044 3300005367 Unclassified 1076
15 Ga0070714_100025353 3300005435 Bacteria 4893
16 Ga0070678_100622968 3300005456 Unclassified 965
17 Ga0070681_10049501 3300005458 Bacteria 4196
18 Ga0070681_10205298 3300005458 Bacteria 1888
19 Ga0070681_10790180 3300005458 Unclassified 866
20 Ga0070679_100447741 3300005530 Bacteria 1236
21 Ga0070684_100159156 3300005535 Bacteria 2048
22 Ga0068853_100167922 3300005539 Bacteria 1984
23 Ga0070686_100012758 3300005544 Bacteria 4795
24 Ga0070704_100074039 3300005549 Bacteria 2483
25 Ga0068855_100165661 3300005563 Eukaryota 2506
26 Ga0068855_100197671 3300005563 Unclassified 2265
27 Ga0068856_100075733 3300005614 Bacteria 3333
28 Ga0068856_100235588 3300005614 Bacteria 1846
29 Ga0068859_100357597 3300005617 Bacteria 1555
30 Ga0068864_100456161 3300005618 Bacteria 1223
31 Ga0068864_100497194 3300005618 Bacteria 1173
32 Ga0068863_101206790 3300005841 Bacteria 762
33 Ga0068862_100204241 3300005844 Bacteria 1783
34 Ga0075428_100004195 3300006844 Bacteria 15867
35 Ga0075428_100160565 3300006844 Bacteria 2440
36 Ga0075429_100351054 3300006880 Unclassified 1291
37 Ga0075429_100484112 3300006880 Bacteria 1084
38 Ga0097620_100357591 3300006931 Bacteria 1555
39 Ga0075435_100478687 3300007076 Unclassified 1075
40 Ga0105240_10069209 3300009093 Bacteria 4370
41 Ga0105240_10141553 3300009093 Bacteria 2875
42 Ga0105240_10150010 3300009093 Bacteria 2778
43 Ga0111539_10008564 3300009094 Bacteria 12987
44 Ga0105241_10382598 3300009174 Bacteria 1230
45 Ga0105248_10453846 3300009177 Unclassified 1444
46 Ga0105248_11017023 3300009177 Unclassified 936
47 Ga0105248_11040218 3300009177 Unclassified 925
48 Ga0105238_10032475 3300009551 Bacteria 5312
49 Ga0105238_10040954 3300009551 Bacteria 4693
50 Ga0105249_10582275 3300009553 Bacteria 1172
51 Ga0157370_10018876 3300013104 Bacteria 6935
52 Ga0157370_10960855 3300013104 Unclassified 774
53 Ga0157374_10840762 3300013296 Unclassified 934
54 Ga0157378_10058745 3300013297 Bacteria 3430
55 Ga0163162_10726020 3300013306 Unclassified 1114
56 Ga0157372_10368012 3300013307 Unclassified 1675
57 Ga0157375_10296111 3300013308 Bacteria 1781
58 Ga0163163_10280591 3300014325 Bacteria 1717
59 Ga0163163_10652765 3300014325 Unclassified 1116
60 Ga0157376_10554719 3300014969 Bacteria 1137
61 Ga0207705_10218953 3300025909 Bacteria 1445
62 Ga0207654_10212818 3300025911 Bacteria 1278
63 Ga0207707_10110781 3300025912 Bacteria 2400
64 Ga0207707_10624057 3300025912 Unclassified 910
65 Ga0207695_10092311 3300025913 Bacteria 3038
66 Ga0207660_10697135 3300025917 Bacteria 828
67 Ga0207657_10209261 3300025919 Bacteria 1566
68 Ga0207652_10520338 3300025921 Bacteria 1070
69 Ga0207694_10028477 3300025924 Bacteria 4259
70 Ga0207694_10050554 3300025924 Bacteria 3220
71 Ga0207659_10089180 3300025926 Bacteria 2299
72 Ga0207670_10395444 3300025936 Bacteria 1104
73 Ga0207711_10262257 3300025941 Bacteria 1588
74 Ga0207661_10747367 3300025944 Unclassified 900
75 Ga0207667_10068603 3300025949 Bacteria 3692
76 Ga0207667_10686515 3300025949 Unclassified 1027
77 Ga0207639_10224946 3300026041 Bacteria 1623
78 Ga0207702_10235875 3300026078 Bacteria 1712
79 Ga0207676_10376770 3300026095 Bacteria 1320
80 Ga0207428_10189542 3300027907 Bacteria 1550
81 Ga0268265_10045732 3300028380 Bacteria 3269
82 Ga0265337_1002737 3300028556 Bacteria 7917
83 Ga0265338_10002878 3300028800 Bacteria 25114
84 Ga0265338_10082488 3300028800 Bacteria 2692
85 Ga0265338_10117692 3300028800 Unclassified 2125
86 Ga0265338_10225203 3300028800 Unclassified 1398
87 Ga0265338_10415644 3300028800 Unclassified 957
88 Ga0265338_10625527 3300028800 Unclassified 748
89 Ga0265316_10619951 3300031344 Unclassified 766
90 Ga0307405_10564595 3300031731 Unclassified 923
91 Ga0373956_0108560 3300035119 Unclassified 1291
92 Ga0373955_0296089 3300035172 Unclassified 975
93 Ga0395905_0199602 3300037471 Bacteria 1875
94 Ga0395901_1119421 3300038443 Unclassified 757
95 Ga0451576_0175764 3300045051 Unclassified 2235
96 Ga0451576_0201993 3300045051 Bacteria 2076
97 Ga0451576_1070145 3300045051 Unclassified 844
98 Ga0495653_0463757 3300046463 Unclassified 795
99 Ga0495594_0363642 3300046499 Unclassified 824
100 Ga0495618_0390864 3300046514 Unclassified 852
101 Ga0495652_0533282 3300046529 Unclassified 809
102 Ga0495621_0242997 3300046539 Unclassified 734
103 Ga0495645_0078844 3300046543 Unclassified 2367
104 Ga0495645_0110453 3300046543 Archaea 1946
105 Ga0495634_0160263 3300046642 Bacteria 1419
106 Ga0495657_0029043 3300046675 Bacteria 3882
107 Ga0495599_0022001 3300046678 Bacteria 3979
108 Ga0495599_0227179 3300046678 Unclassified 1140
109 Ga0501034_0203867 3300049571 Unclassified 1935
110 Ga0501070_0214575 3300049586 Bacteria 1579
111 nmdc:mga09592_354692_c1 3300050508 Unclassified 1269
112 nmdc:mga06r32_470683_c1 3300050510 Bacteria 1235
113 nmdc:mga08y16_14729_c1 3300050511 Bacteria 8222
114 Ga0157370_10146366
115 rootH1_10227244
116 Ga0070683_100921544
117 Ga0070677_10071527
118 Ga0068869_100186910
119 Ga0070680_100771191
120 Ga0070660_100520122
121 Ga0070689_100089683
122 Ga0070689_100147315
123 Ga0070689_100454076
124 Ga0070668_100248064
125 Ga0070675_100084514
126 Ga0070688_100140753
127 Ga0070667_100535044
128 Ga0070714_100025353
129 Ga0070678_100622968
130 Ga0070681_10049501
131 Ga0070681_10205298
132 Ga0070681_10790180
133 Ga0070679_100447741
134 Ga0070684_100159156
135 Ga0068853_100167922
136 Ga0070686_100012758
137 Ga0070704_100074039
138 Ga0068855_100165661
139 Ga0068855_100197671
140 Ga0068856_100075733
141 Ga0068856_100235588
142 Ga0068859_100357597
143 Ga0068864_100456161
144 Ga0068864_100497194
145 Ga0068863_101206790
146 Ga0068862_100204241
147 Ga0075428_100004195
148 Ga0075428_100160565
149 Ga0075429_100351054
150 Ga0075429_100484112
151 Ga0097620_100357591
152 Ga0075435_100478687
153 Ga0105240_10069209
154 Ga0105240_10141553
155 Ga0105240_10150010
156 Ga0111539_10008564
157 Ga0105241_10382598
158 Ga0105248_10453846
159 Ga0105248_11017023
160 Ga0105248_11040218
161 Ga0105238_10032475
162 Ga0105238_10040954
163 Ga0105249_10582275
164 Ga0157370_10018876
165 Ga0157370_10960855
166 Ga0157374_10840762
167 Ga0157378_10058745
168 Ga0163162_10726020
169 Ga0157372_10368012
170 Ga0157375_10296111
171 Ga0163163_10280591
172 Ga0163163_10652765
173 Ga0157376_10554719
174 Ga0207705_10218953
175 Ga0207654_10212818
176 Ga0207707_10110781
177 Ga0207707_10624057
178 Ga0207695_10092311
179 Ga0207660_10697135
180 Ga0207657_10209261
181 Ga0207652_10520338
182 Ga0207694_10028477
183 Ga0207694_10050554
184 Ga0207659_10089180
185 Ga0207670_10395444
186 Ga0207711_10262257
187 Ga0207661_10747367
188 Ga0207667_10068603
189 Ga0207667_10686515
190 Ga0207639_10224946
191 Ga0207702_10235875
192 Ga0207676_10376770
193 Ga0207428_10189542
194 Ga0268265_10045732
195 Ga0265337_1002737
196 Ga0265338_10002878
197 Ga0265338_10082488
198 Ga0265338_10117692
199 Ga0265338_10225203
200 Ga0265338_10415644
201 Ga0265338_10625527
202 Ga0265316_10619951
203 Ga0307405_10564595
204 Ga0373956_0108560
205 Ga0373955_0296089
206 Ga0395905_0199602
207 Ga0395901_1119421
208 Ga0451576_0175764
209 Ga0451576_0201993
210 Ga0451576_1070145
211 Ga0495653_0463757
212 Ga0495594_0363642
213 Ga0495618_0390864
214 Ga0495652_0533282
215 Ga0495621_0242997
216 Ga0495645_0078844
217 Ga0495645_0110453
218 Ga0495634_0160263
219 Ga0495657_0029043
220 Ga0495599_0022001
221 Ga0495599_0227179
222 Ga0501034_0203867
223 Ga0501070_0214575
224 nmdc:mga09592_354692_c1
225 nmdc:mga06r32_470683_c1
226 nmdc:mga08y16_14729_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02565

RecO_C

Recombination protein O C terminal

86

156

0.94

PF11967

RecO_N

Recombination protein O N terminal

1

82

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u5k-assembly1.cif.gz_A recombinational repair protein reco 0.8476 3 216
1u5k-assembly1.cif.gz_B recombinational repair protein reco 0.8459 3 211
1u5k-assembly1.cif.gz_A recombinational repair protein reco 0.8369 3 216
1w3s-assembly1.cif.gz_A the crystal structure of reco from deinococcus radiodurans. 0.8366 3 210
1u5k-assembly1.cif.gz_B recombinational repair protein reco 0.817 3 211
ID Description Score Start End Superfamily
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.931 1 87 2.40.50.140
af_Q2FY07_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9294 4 80 2.40.50.140
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9202 1 87 2.40.50.140
af_Q2FY07_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9178 4 80 2.40.50.140
3q8dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9095 5 80 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A6N6Q6M8-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9802 2 212 GO:0006302
GO:0006310
GO:0043590
AF-A0A7C5GUF5-F1-model_v4 DNA repair protein RecO 0.974 4 112 GO:0006302
GO:0006310
GO:0043590
AF-A0A538PCU0-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9686 2 157 GO:0006302
GO:0006310
GO:0043590
AF-A0A7Y2X5L6-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9645 2 212 GO:0006302
GO:0006310
GO:0043590
AF-A0A1Q6XBG2-F1-model_v4 DNA repair protein RecO 0.9638 1 128 GO:0006302
GO:0006310
GO:0043590

Map