F070157

General Info

Members Datasets Scaffolds Average Seq Length
112 80 92 688

Family's Representative Sequence

Representative Sequence 3300038735|Ga0400485_18908|Ga0400485_18908_2784_4979
Length 731
Sequence MPSTRSHPHPLGVHPCAAGAEVAVFASSAEAVEFCLLDRDSSGEWRERRTPLPHHRHGVWFGTVPDVRPGQRYGLRAHGPWDPARGLRFNPAKLLLDPYARAHSGTLRLRPELFGHTVDDRFVGDTAVPDPRDSAPHAPHGIVVGAGALWGADEPPDIPWSDTVIYEAHVSGLTRRLPGVPEPLRGTYAGLAHDATLDYLTGLGVTAVELLPVQAIGTEPALARRGRVNYWGYSTLGFFAPHPGYAAATDPLAVLEEFRHLVRRLHGAGLELILDVVLNHTCETDETGPTLSWRGLDAPAYYLLDDRGRHWDTTGCGNSLNARHPRVVQMMLDSLRYWVESAHVDGFRFDLAPTLARGRDGFDPDHPFLVAARADPVLQRVKLIAEPWDVGPRGWRTGQFPPPFAEWNDRFRDTARHFWLSAPAGADPGDGIRALATRLAGSDDLFSADRGPLASVNFITAHDGFTLADLTAYDRKHNEENGXXXRDGSDLNLSWNHGTEGATTDPDILAARRRSARNLLGTLLLSAGVPMLVAGDERGRTQGGNNNPYCVDGPTTWLDWHAEASRTDLTETVRFLLALRRDHPVLRQERSFADRVTQPDGSRDIVWFGDDGRELGDAQWSDPRQRIVQLLLTGPDEGSGTGSVLLVVQGSXQGTRIRLPEPPGRQSWYRLLWDSVDERPGPARNRPVEPAGTVVTVAGPSVRVYAVLRDGTGEPAGTGGSGVGDQSEFGG

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2643221575 Microbacterium sp. Root61 Isolate Unclassified
3 2643221597 Microbacterium sp. Root180 Isolate Unclassified
4 2643221616 Leifsonia sp. Root227 Isolate Unclassified
5 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
6 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
7 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
8 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
9 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
10 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
11 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
12 2919069694 Microbacterium sp. 1154 Isolate Unclassified
13 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
14 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
15 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
16 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
17 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
18 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
29 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
30 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
31 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
32 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
37 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
38 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
39 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
40 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
41 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
42 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
43 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
44 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
45 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
46 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
47 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
48 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
49 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
50 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
51 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
52 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
53 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
54 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
55 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
56 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
57 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
62 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
63 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
64 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
65 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
67 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
68 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
69 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
70 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
71 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
72 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
73 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
74 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
75 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
76 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
77 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
78 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
79 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
80 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.14
Metatranscriptomes 0
Isolates 17.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.89
Bulb 0
Endosphere 24.11
Nodule 0
Rhizoplane 6.25
Rhizosphere 31.25
Stem 0
Stem Tuber 0
Unclassified 37.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10083537 3300005327 Bacteria 2625
2 Ga0070707_100013334 3300005468 Bacteria 7689
3 Ga0068855_100100197 3300005563 Bacteria 3336
4 Ga0081539_10000376 3300005985 Bacteria 97498
5 Ga0075365_10004965 3300006038 Bacteria 7120
6 Ga0075365_10024265 3300006038 Bacteria 3822
7 Ga0075367_10004760 3300006178 Bacteria 6675
8 Ga0075369_10010980 3300006186 Bacteria 3553
9 Ga0075369_10011224 3300006186 Bacteria 3521
10 Ga0157371_10003552 3300013102 Bacteria 14069
11 Ga0207705_10000213 3300025909 Bacteria 58174
12 Ga0265334_10015795 3300028573 Bacteria 3132
13 Ga0307515_10037529 3300028794 Bacteria 7789
14 Ga0265340_10001445 3300031247 Bacteria 13625
15 Ga0307513_10036728 3300031456 Bacteria 5460
16 Ga0307408_100008194 3300031548 Bacteria 6904
17 Ga0307406_10014855 3300031901 Bacteria 4489
18 Ga0307409_100002974 3300031995 Bacteria 9032
19 Ga0307416_100006566 3300032002 Bacteria 7295
20 Ga0400485_18908 3300038735 Bacteria 69934
21 Ga0400486_03657 3300038742 Bacteria 72353
22 Ga0451793_1205611 3300041452 Bacteria 3017
23 Ga0466965_0029458 3300044683 Bacteria 2672
24 Ga0495590_0000242 3300046457 Bacteria 29848
25 Ga0495650_0001013 3300046471 Bacteria 31698
26 Ga0495672_0005490 3300047320 Bacteria 10049
27 Ga0496104_0016669 3300048907 Bacteria 6677
28 Ga0496105_0006436 3300048908 Bacteria 9029
29 Ga0496109_0057393 3300048912 Bacteria 3553
30 Ga0496109_0087058 3300048912 Bacteria 2885
31 Ga0496114_0023105 3300048917 Bacteria 5069
32 Ga0496114_0024783 3300048917 Bacteria 4898
33 Ga0496116_0008426 3300048919 Bacteria 8947
34 Ga0496117_0000053 3300048920 Bacteria 279396
35 Ga0496117_0001576 3300048920 Bacteria 32370
36 Ga0496117_0005515 3300048920 Bacteria 13253
37 Ga0496117_0010858 3300048920 Bacteria 8215
38 Ga0496118_0010413 3300048921 Bacteria 9214
39 Ga0496118_0025935 3300048921 Bacteria 5009
40 Ga0496119_0003914 3300048922 Bacteria 15123
41 Ga0496119_0007824 3300048922 Bacteria 9528
42 Ga0496120_0001117 3300048923 Bacteria 34800
43 Ga0496120_0002581 3300048923 Bacteria 18038
44 Ga0496120_0002782 3300048923 Bacteria 16983
45 Ga0496120_0027958 3300048923 Bacteria 3462
46 Ga0496122_0000031 3300048925 Bacteria 329726
47 Ga0496122_0000194 3300048925 Bacteria 139191
48 Ga0496123_0000013 3300048926 Bacteria 439694
49 Ga0496123_0000350 3300048926 Bacteria 86569
50 Ga0496123_0000681 3300048926 Bacteria 56018
51 Ga0496123_0037629 3300048926 Bacteria 3414
52 Ga0496124_0003767 3300048927 Bacteria 18240
53 Ga0496124_0008895 3300048927 Bacteria 10415
54 Ga0496124_0023149 3300048927 Bacteria 5679
55 Ga0496125_0000077 3300048928 Bacteria 232629
56 Ga0496126_0014786 3300048929 Bacteria 7873
57 Ga0496126_0046112 3300048929 Bacteria 4001
58 Ga0496126_0059818 3300048929 Bacteria 3430
59 Ga0501034_0000954 3300049571 Bacteria 41786
60 Ga0501034_0120170 3300049571 Bacteria 2614
61 Ga0501034_0126012 3300049571 Bacteria 2546
62 Ga0501036_0025038 3300049572 Bacteria 5033
63 Ga0501042_0002289 3300049578 Bacteria 11699
64 Ga0501047_0021954 3300049581 Bacteria 6130
65 Ga0501070_0006307 3300049586 Bacteria 10093
66 Ga0501073_0009672 3300049589 Bacteria 7108
67 Ga0501076_0007529 3300049592 Bacteria 7922
68 Ga0501083_0000031 3300049744 Bacteria 104819
69 Ga0501035_0068450 3300049822 Bacteria 3148
70 Ga0501045_0019946 3300049824 Bacteria 4784
71 nmdc:mga00v17_20095_c1 3300050491 Bacteria 3822
72 nmdc:mga0yw44_29843_c1 3300050492 Bacteria 3153
73 nmdc:mga06z11_5837_c1 3300050494 Bacteria 4970
74 nmdc:mga0sz30_15359_c1 3300050516 Bacteria 3025
75 nmdc:mga0sz30_5879_c1 3300050516 Bacteria 4525
76 Ga0500635_0000010 3300053080 Bacteria 147500
77 Ga0500643_000072 3300053087 Bacteria 112810
78 Ga0500556_0000001 3300053104 Bacteria 1135060
79 Ga0500556_0000086 3300053104 Bacteria 87063
80 Ga0500562_000397 3300053108 Bacteria 10573
81 Ga0500559_0000063 3300053136 Bacteria 87005
82 Ga0500559_0002714 3300053136 Bacteria 8990
83 Ga0500568_0000006 3300053139 Bacteria 522235
84 Ga0500568_0000028 3300053139 Bacteria 161589
85 Ga0500568_0000102 3300053139 Bacteria 78197
86 Ga0500573_0000001 3300053140 Bacteria 436394
87 Ga0500573_0016225 3300053140 Bacteria 4226
88 Ga0500573_0018046 3300053140 Bacteria 4020
89 Ga0500616_0000078 3300053153 Bacteria 202009
90 Ga0500616_0000337 3300053153 Bacteria 66968
91 Ga0500616_0005582 3300053153 Bacteria 8502
92 Ga0500616_0012935 3300053153 Bacteria 4863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0025038 Ga0501036_0025038_2979_4982 627
2 3300049592 Ga0501076_0007529 Ga0501076_0007529_4309_6312 627
3 3300049822 Ga0501035_0068450 Ga0501035_0068450_214_2217 627
4 3300049824 Ga0501045_0019946 Ga0501045_0019946_1922_3925 627
5 3300049571 Ga0501034_0120170 Ga0501034_0120170_224_2371 628
6 3300041452 Ga0451793_1205611 Ga0451793_1205611_324_2414 647
7 3300053140 Ga0500573_0016225 Ga0500573_0016225_2131_4086 649
8 3300028573 Ga0265334_10015795 Ga0265334_100157952 655
9 3300005468 Ga0070707_100013334 Ga0070707_1000133346 659
10 3300031548 Ga0307408_100008194 Ga0307408_1000081943 660
11 3300031901 Ga0307406_10014855 Ga0307406_100148553 660
12 3300031995 Ga0307409_100002974 Ga0307409_1000029745 660
13 3300032002 Ga0307416_100006566 Ga0307416_1000065662 660
14 3300049586 Ga0501070_0006307 Ga0501070_0006307_6406_8505 660
15 3300049589 Ga0501073_0009672 Ga0501073_0009672_4663_6747 660
16 3300005985 Ga0081539_10000376 Ga0081539_1000037675 661
17 3300053136 Ga0500559_0000063 Ga0500559_0000063_67652_69676 661
18 iso_pu_bacteria 2537561592 2537897607 661
19 3300031247 Ga0265340_10001445 Ga0265340_100014453 662
20 3300048929 Ga0496126_0046112 Ga0496126_0046112_1073_3175 662
21 3300049578 Ga0501042_0002289 Ga0501042_0002289_7563_9623 667
22 3300049744 Ga0501083_0000031 Ga0501083_0000031_7221_9281 667
23 3300028794 Ga0307515_10037529 Ga0307515_100375297 668
24 3300048922 Ga0496119_0007824 Ga0496119_0007824_2053_4074 668
25 3300048923 Ga0496120_0002581 Ga0496120_0002581_14133_16154 668
26 3300049571 Ga0501034_0000954 Ga0501034_0000954_23734_25887 668
27 3300053153 Ga0500616_0000337 Ga0500616_0000337_58232_60412 668
28 3300038735 Ga0400485_18908 Ga0400485_18908_2784_4979 670
29 3300038742 Ga0400486_03657 Ga0400486_03657_32363_34558 670
30 3300046457 Ga0495590_0000242 Ga0495590_0000242_24812_26857 670
31 3300046471 Ga0495650_0001013 Ga0495650_0001013_7771_9816 670
32 3300053140 Ga0500573_0000001 Ga0500573_0000001_392307_394331 670
33 3300006038 Ga0075365_10004965 Ga0075365_100049654 671
34 3300006178 Ga0075367_10004760 Ga0075367_100047603 671
35 3300044683 Ga0466965_0029458 Ga0466965_0029458_274_2295 671
36 3300050494 nmdc:mga06z11_5837_c1 nmdc:mga06z11_5837_c1_652_2739 671
37 3300048920 Ga0496117_0010858 Ga0496117_0010858_998_3079 672
38 3300048921 Ga0496118_0010413 Ga0496118_0010413_2897_4978 672
39 3300048923 Ga0496120_0027958 Ga0496120_0027958_816_2897 672
40 3300048925 Ga0496122_0000194 Ga0496122_0000194_76916_78997 672
41 3300048926 Ga0496123_0000350 Ga0496123_0000350_76904_78985 672
42 3300048927 Ga0496124_0008895 Ga0496124_0008895_831_2912 672
43 3300053153 Ga0500616_0005582 Ga0500616_0005582_2861_5035 672
44 3300048907 Ga0496104_0016669 Ga0496104_0016669_168_2255 673
45 3300048912 Ga0496109_0057393 Ga0496109_0057393_263_2350 673
46 3300050516 nmdc:mga0sz30_15359_c1 nmdc:mga0sz30_15359_c1_620_2725 673
47 iso_pu_bacteria 2870622029 2870624206 673
48 3300053140 Ga0500573_0018046 Ga0500573_0018046_1495_3525 674
49 iso_pu_bacteria 2643221616 2644095775 675
50 iso_pu_bacteria 2939657138 2939658679 675
51 iso_pu_bacteria 8057345674 8057347861 675
52 3300047320 Ga0495672_0005490 Ga0495672_0005490_2951_5008 677
53 3300049571 Ga0501034_0126012 Ga0501034_0126012_332_2371 677
54 3300048908 Ga0496105_0006436 Ga0496105_0006436_3394_5511 679
55 3300048917 Ga0496114_0023105 Ga0496114_0023105_2332_4449 679
56 3300048920 Ga0496117_0001576 Ga0496117_0001576_20572_22644 679
57 3300049581 Ga0501047_0021954 Ga0501047_0021954_2016_4136 679
58 3300053080 Ga0500635_0000010 Ga0500635_0000010_60696_62810 679
59 3300053087 Ga0500643_000072 Ga0500643_000072_36828_38876 679
60 3300053104 Ga0500556_0000001 Ga0500556_0000001_682038_684086 679
61 3300053139 Ga0500568_0000006 Ga0500568_0000006_10835_12883 679
62 3300053139 Ga0500568_0000028 Ga0500568_0000028_40281_42326 679
63 3300053139 Ga0500568_0000102 Ga0500568_0000102_23114_25159 679
64 3300053153 Ga0500616_0000078 Ga0500616_0000078_19441_21513 679
65 3300053153 Ga0500616_0012935 Ga0500616_0012935_2468_4555 679
66 3300031456 Ga0307513_10036728 Ga0307513_100367283 681
67 3300048917 Ga0496114_0024783 Ga0496114_0024783_1672_3786 681
68 3300006186 Ga0075369_10011224 Ga0075369_100112242 685
69 3300048912 Ga0496109_0087058 Ga0496109_0087058_634_2784 685
70 3300053136 Ga0500559_0002714 Ga0500559_0002714_808_2910 685
71 iso_pu_bacteria 2773857758 2774380221 686
72 iso_pu_bacteria 2904509784 2904511846 686
73 iso_pu_bacteria 2908678064 2908680763 686
74 iso_pu_bacteria 2919069694 2919071688 686
75 iso_pu_bacteria 2974294766 2974297313 686
76 iso_pu_bacteria 2974324384 2974326448 686
77 iso_pu_bacteria 2977236895 2977236917 686
78 iso_pu_bacteria 2977264416 2977266789 686
79 iso_pu_bacteria 2984542743 2984545293 686
80 3300005327 Ga0070658_10083537 Ga0070658_100835372 687
81 3300005563 Ga0068855_100100197 Ga0068855_1001001972 687
82 3300006038 Ga0075365_10024265 Ga0075365_100242653 687
83 3300006186 Ga0075369_10010980 Ga0075369_100109802 687
84 3300013102 Ga0157371_10003552 Ga0157371_100035523 687
85 3300025909 Ga0207705_10000213 Ga0207705_1000021310 687
86 3300048919 Ga0496116_0008426 Ga0496116_0008426_6608_8692 687
87 3300048920 Ga0496117_0000053 Ga0496117_0000053_139776_141866 687
88 3300048920 Ga0496117_0005515 Ga0496117_0005515_4610_6697 687
89 3300048921 Ga0496118_0025935 Ga0496118_0025935_2031_4115 687
90 3300048922 Ga0496119_0003914 Ga0496119_0003914_2479_4569 687
91 3300048923 Ga0496120_0001117 Ga0496120_0001117_22961_25045 687
92 3300048923 Ga0496120_0002782 Ga0496120_0002782_807_2897 687
93 3300048925 Ga0496122_0000031 Ga0496122_0000031_79270_81354 687
94 3300048926 Ga0496123_0000013 Ga0496123_0000013_79280_81364 687
95 3300048926 Ga0496123_0000681 Ga0496123_0000681_38116_40206 687
96 3300048926 Ga0496123_0037629 Ga0496123_0037629_183_2270 687
97 3300048927 Ga0496124_0003767 Ga0496124_0003767_14206_16296 687
98 3300048927 Ga0496124_0023149 Ga0496124_0023149_1323_3410 687
99 3300048928 Ga0496125_0000077 Ga0496125_0000077_11636_13711 687
100 3300048929 Ga0496126_0014786 Ga0496126_0014786_510_2594 687
101 3300048929 Ga0496126_0059818 Ga0496126_0059818_1322_3412 687
102 3300050491 nmdc:mga00v17_20095_c1 nmdc:mga00v17_20095_c1_748_2847 687
103 3300050492 nmdc:mga0yw44_29843_c1 nmdc:mga0yw44_29843_c1_643_2742 687
104 3300050516 nmdc:mga0sz30_5879_c1 nmdc:mga0sz30_5879_c1_553_2643 687
105 3300053104 Ga0500556_0000086 Ga0500556_0000086_34604_36760 687
106 3300053108 Ga0500562_000397 Ga0500562_000397_7738_9840 687
107 iso_pu_bacteria 2643221575 2643885244 687
108 iso_pu_bacteria 2643221597 2643996042 687
109 iso_pu_bacteria 2808606447 2809227561 687
110 iso_pu_bacteria 2811994872 2812323362 687
111 iso_pu_bacteria 2852632344 2852634322 687
112 iso_pu_bacteria 8016254467 8016257398 687

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02922

CBM_48

Carbohydrate-binding module 48 (Isoamylase N-terminal domain)

10

100

0.93

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

186

303

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u3b-assembly4.cif.gz_G structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) 0.8967 15 687
7u3b-assembly1.cif.gz_C structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) 0.8967 15 687
7u3a-assembly1.cif.gz_A structure of the streptomyces venezuelae glgx-c-di-gmp complex 0.8934 15 687
7u3a-assembly1.cif.gz_B structure of the streptomyces venezuelae glgx-c-di-gmp complex 0.8924 15 685
7u3b-assembly2.cif.gz_F structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) 0.8923 15 685
ID Description Score Start End Superfamily
2wskA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9214 124 571 3.20.20.80
2vuyA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9054 123 575 3.20.20.80
2vuyA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.902 123 575 3.20.20.80
2wskA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8993 124 571 3.20.20.80
2vuyA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8974 15 119 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7Y9MFF4-F1-model_v4 Glycogen operon protein (EC 3.2.1.-) 0.9659 12 687 GO:0004133
GO:0004553
GO:0005980
AF-A0A443IWY1-F1-model_v4 Glycogen debranching enzyme 0.9653 254 451
AF-A0A1Y6EJ55-F1-model_v4 Glycogen operon protein 0.9647 12 687 GO:0004133
GO:0004553
GO:0005980
AF-A0A0Q5EF18-F1-model_v4 Glycosyl hydrolase 0.9645 12 687 GO:0004133
GO:0004553
GO:0005980
AF-A0A6P1FFG6-F1-model_v4 Glycogen debranching protein GlgX 0.9639 13 687 GO:0004133
GO:0004553
GO:0005980

Feature Viewer

pLDDT pTM Quality
87.57 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map