F065023

General Info

Members Datasets Scaffolds Average Seq Length
111 74 111 549

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0002514|Ga0373956_0002514_1770_3617
Length 615
Sequence MERGRLIREFFQCSQSANFDLSGKKCFHPPMAPCVIFEDEHLLVVHKPAGWNTHAPGLYAGEGIYDWLRHREPRWSSLAILHRLDKETSGVLVFGKTPAANRSLTEQFTQRRVRKKYLLLTDRVVPGSEFTVKSALVRVGEKYVSRPPHAGAEIAETKFRRFNEMSQAGRAVPGPPRHGGDIVPCQYVEAEPLTGKTHQIRVHAADKGFPILGDALYGGTPAARVFLHAAEISFTHPATRKPVTFAVPAGSAGDEVSGLKLKKEKSGPPHVDFCYLRSAIIEPEATNAFRVIHGASDGWPGWYVDRLGDFLLSQSEHPLRAEQREELLLLVKTLSLRGVYHKILSRQIRCTPTADLSPQLVLGEAAPKRFEIVENGVRFELSFNEGYSVGLFLDQRDNRRRFLTGHIAADFPLTSEGRVSRVPISSATDNSGTRETRPSEADFEILNCFAYTCGFSVCAARAGIRTMSLDLSKRYLEWGRRNFALNGLDPAAHDFIYGDAFDWLRRLAKKGRAFDAVVLDPPTFSQSKESGVFRAEKDYATLVAAALPLVKAGGILFAATNAAGWPPEAFLADVETAIRQSQRKILQRQFFPQPPDFPVSHGEPAYLKTFWLRVG

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
4 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
5 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
10 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
11 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
12 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
13 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
17 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
18 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
19 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
30 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
31 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
32 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
33 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
34 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
35 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
36 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
37 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
38 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
39 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
40 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
41 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
44 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
45 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
46 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
47 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
48 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
49 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
50 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
51 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
54 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
55 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
56 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
57 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
58 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
59 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
60 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
61 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
62 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
63 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
64 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
65 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
66 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
67 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
68 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
69 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
70 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
71 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.9
Rhizosphere 99.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100021571 3300005340 Bacteria 4799
2 Ga0070714_100001234 3300005435 Bacteria 18443
3 Ga0070700_100030224 3300005441 Bacteria 3236
4 Ga0070681_10017115 3300005458 Bacteria 7247
5 Ga0070684_100056376 3300005535 Bacteria 3429
6 Ga0068855_100044464 3300005563 Bacteria 5255
7 Ga0068855_100086881 3300005563 Bacteria 3615
8 Ga0068855_100094599 3300005563 Bacteria 3445
9 Ga0068857_100003737 3300005577 Bacteria 12782
10 Ga0068856_100000747 3300005614 Bacteria 35242
11 Ga0068856_100046544 3300005614 Bacteria 4273
12 Ga0068863_100060784 3300005841 Bacteria 3573
13 Ga0068863_100062186 3300005841 Bacteria 3531
14 Ga0075428_100059234 3300006844 Bacteria 4193
15 Ga0075431_100168362 3300006847 Bacteria 2252
16 Ga0105240_10047054 3300009093 Bacteria 5460
17 Ga0105240_10054090 3300009093 Bacteria 5032
18 Ga0105240_10072736 3300009093 Bacteria 4248
19 Ga0111539_10091976 3300009094 Bacteria 3564
20 Ga0105238_10004233 3300009551 Bacteria 14253
21 Ga0105238_10082707 3300009551 Bacteria 3200
22 Ga0157372_10040924 3300013307 Bacteria 5122
23 Ga0157375_10000023 3300013308 Bacteria 235137
24 Ga0157375_10026043 3300013308 Bacteria 5445
25 Ga0163163_10000018 3300014325 Bacteria 199503
26 Ga0163163_10106343 3300014325 Bacteria 2832
27 Ga0157376_10179985 3300014969 Bacteria 1932
28 Ga0207707_10025686 3300025912 Bacteria 5152
29 Ga0207695_10036432 3300025913 Bacteria 5318
30 Ga0207694_10004120 3300025924 Bacteria 11418
31 Ga0207700_10038765 3300025928 Bacteria 3462
32 Ga0207664_10004478 3300025929 Bacteria 9463
33 Ga0207670_10015151 3300025936 Unclassified 4597
34 Ga0207667_10016208 3300025949 Bacteria 8423
35 Ga0207702_10000285 3300026078 Bacteria 58642
36 Ga0207641_10044325 3300026088 Bacteria 3741
37 Ga0207641_10077041 3300026088 Bacteria 2884
38 Ga0207674_10002184 3300026116 Bacteria 24751
39 Ga0265337_1000670 3300028556 Bacteria 18106
40 Ga0265326_10002804 3300028558 Bacteria 5833
41 Ga0265334_10025554 3300028573 Bacteria 2390
42 Ga0265323_10000079 3300028653 Bacteria 54842
43 Ga0265322_10006338 3300028654 Bacteria 3480
44 Ga0265322_10016021 3300028654 Bacteria 2165
45 Ga0265336_10000242 3300028666 Bacteria 38866
46 Ga0265338_10000129 3300028800 Bacteria 138608
47 Ga0265338_10001117 3300028800 Bacteria 44576
48 Ga0265338_10002234 3300028800 Bacteria 29513
49 Ga0265338_10002504 3300028800 Bacteria 27359
50 Ga0265338_10003214 3300028800 Bacteria 23299
51 Ga0265338_10003642 3300028800 Bacteria 21465
52 Ga0265338_10010583 3300028800 Bacteria 10787
53 Ga0265338_10017618 3300028800 Bacteria 7687
54 Ga0265338_10027234 3300028800 Bacteria 5739
55 Ga0265338_10068548 3300028800 Bacteria 3055
56 Ga0265338_10078715 3300028800 Unclassified 2778
57 Ga0265338_10079165 3300028800 Bacteria 2767
58 Ga0265338_10144728 3300028800 Bacteria 1856
59 Ga0265324_10000409 3300029957 Bacteria 30860
60 Ga0265328_10016626 3300031239 Bacteria 2858
61 Ga0265320_10005184 3300031240 Bacteria 8405
62 Ga0265320_10031940 3300031240 Bacteria 2700
63 Ga0265329_10004157 3300031242 Bacteria 6106
64 Ga0265327_10001617 3300031251 Bacteria 27249
65 Ga0265327_10009197 3300031251 Bacteria 7169
66 Ga0265327_10056711 3300031251 Bacteria 2017
67 Ga0265316_10020006 3300031344 Bacteria 5709
68 Ga0265316_10043874 3300031344 Bacteria 3560
69 Ga0265316_10095339 3300031344 Unclassified 2266
70 Ga0265316_10113649 3300031344 Bacteria 2049
71 Ga0265314_10006112 3300031711 Bacteria 10701
72 Ga0265314_10009504 3300031711 Bacteria 8199
73 Ga0265342_10069327 3300031712 Unclassified 2059
74 Ga0373928_0000163 3300035084 Bacteria 12854
75 Ga0373929_0000239 3300035085 Bacteria 10050
76 Ga0373944_0000041 3300035089 Bacteria 21249
77 Ga0373932_0000001 3300035112 Bacteria 1459067
78 Ga0373956_0002514 3300035119 Bacteria 7467
79 Ga0373962_0000021 3300035242 Bacteria 43462
80 Ga0373931_0000004 3300035691 Bacteria 535140
81 Ga0373927_0020247 3300035695 Bacteria 4363
82 Ga0373927_0025239 3300035695 Bacteria 3884
83 Ga0373937_0021723 3300036401 Bacteria 5761
84 Ga0373925_0001193 3300037068 Bacteria 22925
85 Ga0373925_0036288 3300037068 Bacteria 3638
86 Ga0451577_0101723 3300042876 Bacteria 2568
87 Ga0453684_0143656 3300044712 Bacteria 2846
88 Ga0451576_0065923 3300045051 Bacteria 3770
89 Ga0495664_0069379 3300046477 Bacteria 2104
90 Ga0495618_0003029 3300046514 Bacteria 10616
91 Ga0495630_0002931 3300046517 Bacteria 11857
92 Ga0495630_0030142 3300046517 Bacteria 4034
93 Ga0495586_0002319 3300046535 Bacteria 10347
94 Ga0495586_0003202 3300046535 Bacteria 8798
95 Ga0495645_0101391 3300046543 Bacteria 2046
96 Ga0495622_0020362 3300046557 Unclassified 3089
97 Ga0495634_0002277 3300046642 Bacteria 16062
98 Ga0495599_0025789 3300046678 Bacteria 3682
99 Ga0495599_0046281 3300046678 Bacteria 2728
100 Ga0495613_0000430 3300046689 Bacteria 35890
101 Ga0495624_0040161 3300046690 Bacteria 2998
102 Ga0495674_0022983 3300047319 Bacteria 5745
103 Ga0495674_0042363 3300047319 Bacteria 4061
104 Ga0495676_0034207 3300047321 Bacteria 4267
105 Ga0495680_0005367 3300047322 Bacteria 12086
106 Ga0496107_0008999 3300048910 Bacteria 6921
107 Ga0501031_0000052 3300049568 Bacteria 63006
108 Ga0501033_0005851 3300049570 Bacteria 9666
109 Ga0501043_0092822 3300049579 Bacteria 2373
110 Ga0501044_0002335 3300049823 Bacteria 21627
111 Ga0501044_0045418 3300049823 Bacteria 4551

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100168362 Ga0075431_1001683622 495
2 3300045051 Ga0451576_0065923 Ga0451576_0065923_919_2523 500
3 3300014969 Ga0157376_10179985 Ga0157376_101799852 505
4 3300028800 Ga0265338_10079165 Ga0265338_100791652 507
5 3300031240 Ga0265320_10005184 Ga0265320_100051843 507
6 3300031251 Ga0265327_10009197 Ga0265327_100091972 507
7 3300046535 Ga0495586_0003202 Ga0495586_0003202_5616_7172 508
8 3300046690 Ga0495624_0040161 Ga0495624_0040161_1320_2876 508
9 3300047321 Ga0495676_0034207 Ga0495676_0034207_1028_2584 508
10 3300005458 Ga0070681_10017115 Ga0070681_100171154 515
11 3300005563 Ga0068855_100094599 Ga0068855_1000945992 515
12 3300005614 Ga0068856_100046544 Ga0068856_1000465444 515
13 3300025949 Ga0207667_10016208 Ga0207667_100162087 515
14 3300031251 Ga0265327_10001617 Ga0265327_1000161714 515
15 3300048910 Ga0496107_0008999 Ga0496107_0008999_4989_6584 515
16 3300005563 Ga0068855_100044464 Ga0068855_1000444644 516
17 3300005614 Ga0068856_100000747 Ga0068856_10000074710 516
18 3300006844 Ga0075428_100059234 Ga0075428_1000592344 516
19 3300009093 Ga0105240_10054090 Ga0105240_100540903 516
20 3300026078 Ga0207702_10000285 Ga0207702_1000028539 516
21 3300042876 Ga0451577_0101723 Ga0451577_0101723_656_2275 516
22 3300005435 Ga0070714_100001234 Ga0070714_10000123412 517
23 3300014325 Ga0163163_10106343 Ga0163163_101063432 517
24 3300028800 Ga0265338_10010583 Ga0265338_100105835 517
25 3300009551 Ga0105238_10004233 Ga0105238_100042338 518
26 3300025924 Ga0207694_10004120 Ga0207694_100041206 518
27 3300046557 Ga0495622_0020362 Ga0495622_0020362_1035_2801 518
28 3300009551 Ga0105238_10082707 Ga0105238_100827072 519
29 3300025912 Ga0207707_10025686 Ga0207707_100256862 519
30 3300028558 Ga0265326_10002804 Ga0265326_100028046 519
31 3300035084 Ga0373928_0000163 Ga0373928_0000163_4478_6070 519
32 3300035085 Ga0373929_0000239 Ga0373929_0000239_6638_8230 519
33 3300035089 Ga0373944_0000041 Ga0373944_0000041_9153_10745 519
34 3300035112 Ga0373932_0000001 Ga0373932_0000001_481705_483297 519
35 3300035242 Ga0373962_0000021 Ga0373962_0000021_13488_15080 519
36 3300035691 Ga0373931_0000004 Ga0373931_0000004_481714_483306 519
37 3300035695 Ga0373927_0020247 Ga0373927_0020247_2647_4239 519
38 3300035695 Ga0373927_0025239 Ga0373927_0025239_1376_2968 519
39 3300037068 Ga0373925_0001193 Ga0373925_0001193_14528_16120 519
40 3300037068 Ga0373925_0036288 Ga0373925_0036288_317_1909 519
41 3300049568 Ga0501031_0000052 Ga0501031_0000052_2140_3738 519
42 3300049823 Ga0501044_0002335 Ga0501044_0002335_1828_3426 519
43 3300005535 Ga0070684_100056376 Ga0070684_1000563762 520
44 3300005563 Ga0068855_100086881 Ga0068855_1000868811 520
45 3300005577 Ga0068857_100003737 Ga0068857_1000037374 520
46 3300013307 Ga0157372_10040924 Ga0157372_100409243 520
47 3300026116 Ga0207674_10002184 Ga0207674_1000218422 520
48 3300025929 Ga0207664_10004478 Ga0207664_100044786 521
49 3300028573 Ga0265334_10025554 Ga0265334_100255542 521
50 3300028800 Ga0265338_10000129 Ga0265338_1000012921 521
51 3300028800 Ga0265338_10002234 Ga0265338_1000223420 521
52 3300028800 Ga0265338_10003642 Ga0265338_100036429 521
53 3300028800 Ga0265338_10017618 Ga0265338_100176182 521
54 3300028800 Ga0265338_10027234 Ga0265338_100272342 521
55 3300028800 Ga0265338_10068548 Ga0265338_100685482 521
56 3300028800 Ga0265338_10144728 Ga0265338_101447282 521
57 3300029957 Ga0265324_10000409 Ga0265324_100004094 521
58 3300031344 Ga0265316_10095339 Ga0265316_100953392 521
59 3300031712 Ga0265342_10069327 Ga0265342_100693272 521
60 3300044712 Ga0453684_0143656 Ga0453684_0143656_347_1936 521
61 3300049570 Ga0501033_0005851 Ga0501033_0005851_5826_7460 521
62 3300028654 Ga0265322_10016021 Ga0265322_100160212 522
63 3300031239 Ga0265328_10016626 Ga0265328_100166262 522
64 3300031242 Ga0265329_10004157 Ga0265329_100041574 522
65 3300031344 Ga0265316_10113649 Ga0265316_101136491 522
66 3300031711 Ga0265314_10009504 Ga0265314_100095044 522
67 3300009094 Ga0111539_10091976 Ga0111539_100919762 523
68 3300028800 Ga0265338_10078715 Ga0265338_100787153 523
69 3300028653 Ga0265323_10000079 Ga0265323_1000007934 524
70 3300028654 Ga0265322_10006338 Ga0265322_100063382 524
71 3300028800 Ga0265338_10001117 Ga0265338_1000111735 524
72 3300031344 Ga0265316_10043874 Ga0265316_100438742 524
73 3300046517 Ga0495630_0002931 Ga0495630_0002931_6601_8307 524
74 3300046535 Ga0495586_0002319 Ga0495586_0002319_2029_3735 524
75 3300046678 Ga0495599_0046281 Ga0495599_0046281_534_2177 524
76 3300047319 Ga0495674_0042363 Ga0495674_0042363_962_2668 524
77 3300005441 Ga0070700_100030224 Ga0070700_1000302242 525
78 3300025928 Ga0207700_10038765 Ga0207700_100387652 525
79 3300028800 Ga0265338_10003214 Ga0265338_100032145 525
80 3300028556 Ga0265337_1000670 Ga0265337_100067012 526
81 3300028666 Ga0265336_10000242 Ga0265336_100002429 526
82 3300028800 Ga0265338_10002504 Ga0265338_100025044 526
83 3300031240 Ga0265320_10031940 Ga0265320_100319404 526
84 3300031251 Ga0265327_10056711 Ga0265327_100567111 526
85 3300009093 Ga0105240_10047054 Ga0105240_100470544 530
86 3300025913 Ga0207695_10036432 Ga0207695_100364322 530
87 3300013308 Ga0157375_10026043 Ga0157375_100260435 531
88 3300046477 Ga0495664_0069379 Ga0495664_0069379_17_1639 531
89 3300014325 Ga0163163_10000018 Ga0163163_10000018102 532
90 3300046678 Ga0495599_0025789 Ga0495599_0025789_1852_3495 538
91 3300047319 Ga0495674_0022983 Ga0495674_0022983_2334_3977 538
92 3300049579 Ga0501043_0092822 Ga0501043_0092822_144_1805 539
93 3300049823 Ga0501044_0045418 Ga0501044_0045418_1697_3358 539
94 3300005841 Ga0068863_100062186 Ga0068863_1000621861 541
95 3300026088 Ga0207641_10044325 Ga0207641_100443251 541
96 3300031344 Ga0265316_10020006 Ga0265316_100200062 542
97 3300031711 Ga0265314_10006112 Ga0265314_100061126 542
98 3300009093 Ga0105240_10072736 Ga0105240_100727363 543
99 3300013308 Ga0157375_10000023 Ga0157375_10000023183 543
100 3300035119 Ga0373956_0002514 Ga0373956_0002514_1770_3617 544
101 3300036401 Ga0373937_0021723 Ga0373937_0021723_2563_4410 544
102 3300046514 Ga0495618_0003029 Ga0495618_0003029_2421_4268 544
103 3300046517 Ga0495630_0030142 Ga0495630_0030142_35_1792 544
104 3300046543 Ga0495645_0101391 Ga0495645_0101391_148_1854 544
105 3300046642 Ga0495634_0002277 Ga0495634_0002277_8539_10386 544
106 3300046689 Ga0495613_0000430 Ga0495613_0000430_33534_35381 544
107 3300047322 Ga0495680_0005367 Ga0495680_0005367_3114_4961 544
108 3300005340 Ga0070689_100021571 Ga0070689_1000215712 573
109 3300005841 Ga0068863_100060784 Ga0068863_1000607842 573
110 3300025936 Ga0207670_10015151 Ga0207670_100151513 573
111 3300026088 Ga0207641_10077041 Ga0207641_100770412 573

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

41

206

0.95

PF10672

Methyltrans_SAM

S-adenosylmethionine-dependent methyltransferase

429

613

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ldf-assembly1.cif.gz_A crystal structure of smu.776, a putative methyltransferase complexed with sah 0.8771 203 571
3vse-assembly4.cif.gz_D crystal structure of methyltransferase 0.8687 215 571
1ws6-assembly1.cif.gz_A the structure of thermus thermphillus hb8 hypothetical protein ttha0928 0.8465 402 525
3cjt-assembly8.cif.gz_O ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.8405 399 571
3cjt-assembly4.cif.gz_G ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.8403 399 571
ID Description Score Start End Superfamily
af_Q557I0_186_398_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9362 300 533 3.40.50.150
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8741 398 447 3.40.50.150
3vseC03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.871 299 571 3.40.50.150
2b78A03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8705 300 569 3.40.50.150
af_O02325_138_271_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8688 401 478 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2E0QKS2-F1-model_v4 S-adenosylmethionine-dependent methyltransferase domain-containing protein 0.9495 399 573 GO:0008168
GO:0032259
AF-A0A3D3XFK1-F1-model_v4 S-adenosylmethionine-dependent methyltransferase domain-containing protein 0.948 199 572 GO:0008168
GO:0032259
AF-A0A2V5V3T4-F1-model_v4 S-adenosylmethionine-dependent methyltransferase domain-containing protein 0.9469 401 573 GO:0008168
GO:0016020
GO:0032259
AF-A0A2E5EJD1-F1-model_v4 S-adenosylmethionine-dependent methyltransferase domain-containing protein 0.9408 213 573 GO:0008168
GO:0032259
AF-A0A350HY30-F1-model_v4 S-adenosylmethionine-dependent methyltransferase domain-containing protein 0.939 200 520 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
83.76 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map