F061794

General Info

Members Datasets Scaffolds Average Seq Length
111 89 102 283

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10000852|JGI24737J22298_100008526
Length 301
Sequence MKLTLGFSPCPNDTFIFDALIHHKIDTEGLEFEVFYDDVETLNQKAFRGELDITKLSYHAFAYVTDKYVLLDSGSALGFGVGPLLIFSPPITRFFKDDDDKEVFRGESGTSEKVDLIPIVSRSKIGIPGKYTTANFLLSLAFPDATNKTEIVFSEIENSVLNGTIDFGLIIHENRFTYKEKGLAKLVDLGSYWEKRTGCAIPLGGIVANRNLPLDVQHKINRVLRKSVEFAFANPKSGLEFIKQHAQEMSEEVMYKHIELYVNQYSVELGEEGRKAINLMFDTALEKGIIPEVKDGIFLTN

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738543023 Pedobacter sp. OK628 Isolate Unclassified
3 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
4 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
5 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
6 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
7 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
8 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
66 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
67 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
71 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
72 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
73 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
74 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
75 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
76 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
77 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
78 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
79 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
80 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
83 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
84 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
85 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
86 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
87 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
88 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
89 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.89
Metatranscriptomes 0
Isolates 8.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 1.8
Rhizosphere 88.29
Stem 0
Stem Tuber 0
Unclassified 8.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10021757 3300001979 Bacteria 2218
2 JGI24739J22299_10001457 3300001989 Bacteria 8917
3 JGI24737J22298_10000852 3300001990 Bacteria 10878
4 JGI24735J21928_10000027 3300002067 Bacteria 83494
5 JGI24749J21850_1018720 3300002076 Bacteria 978
6 rootH1_10031584 3300003316 Bacteria 16796
7 Ga0065714_10002980 3300005288 Bacteria 14261
8 Ga0065714_10096498 3300005288 Bacteria 1759
9 Ga0065712_10000744 3300005290 Bacteria 14601
10 Ga0070658_10000008 3300005327 Bacteria 319912
11 Ga0070683_100069200 3300005329 Bacteria 3290
12 Ga0070675_100169902 3300005354 Bacteria 1880
13 Ga0070688_100008455 3300005365 Bacteria 5586
14 Ga0070705_100028976 3300005440 Bacteria 3038
15 Ga0070662_100069702 3300005457 Bacteria 2589
16 Ga0070685_10012744 3300005466 Bacteria 4422
17 Ga0068853_100202205 3300005539 Bacteria 1808
18 Ga0070665_100040145 3300005548 Bacteria 4704
19 Ga0068855_100082149 3300005563 Bacteria 3735
20 Ga0068855_100100474 3300005563 Bacteria 3331
21 Ga0068863_100024510 3300005841 Bacteria 5754
22 Ga0081539_10011883 3300005985 Bacteria 6803
23 Ga0075366_10014581 3300006195 Bacteria 4490
24 Ga0075428_100002797 3300006844 Bacteria 18985
25 Ga0075430_100017018 3300006846 Bacteria 6192
26 Ga0075435_100015991 3300007076 Bacteria 5649
27 Ga0105240_10982060 3300009093 Bacteria 904
28 Ga0111539_10363648 3300009094 Bacteria 1684
29 Ga0114129_10004742 3300009147 Bacteria 19211
30 Ga0114129_10175756 3300009147 Bacteria 2917
31 Ga0114129_10303085 3300009147 Bacteria 2129
32 Ga0105239_10085419 3300010375 Bacteria 3478
33 Ga0157373_10000327 3300013100 Bacteria 38493
34 Ga0157373_10000486 3300013100 Bacteria 31473
35 Ga0157371_10001401 3300013102 Bacteria 25151
36 Ga0157370_10006731 3300013104 Bacteria 12608
37 Ga0157369_10000101 3300013105 Bacteria 118683
38 Ga0157369_10145344 3300013105 Bacteria 2507
39 Ga0157369_10283123 3300013105 Bacteria 1726
40 Ga0163162_10024448 3300013306 Bacteria 5963
41 Ga0157372_10000199 3300013307 Bacteria 66101
42 Ga0157372_10000538 3300013307 Bacteria 41695
43 Ga0157372_10000980 3300013307 Bacteria 31160
44 Ga0157372_10132322 3300013307 Bacteria 2871
45 Ga0157372_10211345 3300013307 Bacteria 2248
46 Ga0157372_10594391 3300013307 Bacteria 1290
47 Ga0163163_10019062 3300014325 Bacteria 6437
48 Ga0182008_10023610 3300014497 Bacteria 3138
49 Ga0182008_10133749 3300014497 Bacteria 1238
50 Ga0157376_10102030 3300014969 Unclassified 2509
51 Ga0182007_10026900 3300015262 Bacteria 1989
52 Ga0213876_10010075 3300021384 Bacteria 5079
53 Ga0209026_1000246 3300025250 Bacteria 69164
54 Ga0207705_10000026 3300025909 Bacteria 256051
55 Ga0207671_10164508 3300025914 Bacteria 1719
56 Ga0207686_10350953 3300025934 Bacteria 1111
57 Ga0207670_10442630 3300025936 Bacteria 1046
58 Ga0207661_10068864 3300025944 Bacteria 2883
59 Ga0207667_10120484 3300025949 Bacteria 2704
60 Ga0207667_10628687 3300025949 Bacteria 1081
61 Ga0207648_10290494 3300026089 Bacteria 1464
62 Ga0209969_1013228 3300027360 Bacteria 1194
63 Ga0307517_10001388 3300028786 Bacteria 40654
64 Ga0265338_10012873 3300028800 Bacteria 9505
65 Ga0307408_100000487 3300031548 Bacteria 34716
66 Ga0307408_100263897 3300031548 Bacteria 1427
67 Ga0307412_10196224 3300031911 Bacteria 1530
68 Ga0307414_10001886 3300032004 Bacteria 10825
69 Ga0373937_0349557 3300036401 Bacteria 1400
70 Ga0395899_0000024 3300037312 Bacteria 357402
71 Ga0395899_0000237 3300037312 Bacteria 74249
72 Ga0436365_1931949 3300039437 Bacteria 26658
73 Ga0451795_0416862 3300041456 Bacteria 1166
74 Ga0439450_032300 3300042008 Bacteria 1182
75 Ga0439435_0020254 3300042436 Unclassified 1714
76 Ga0453684_0026302 3300044712 Bacteria 8414
77 Ga0466959_0184994 3300045049 Bacteria 1456
78 Ga0495650_0000098 3300046471 Bacteria 215716
79 Ga0495650_0061083 3300046471 Bacteria 1511
80 Ga0495585_0000308 3300046492 Bacteria 48809
81 Ga0495606_0000021 3300046507 Bacteria 271238
82 Ga0495606_0006041 3300046507 Bacteria 11328
83 Ga0495610_0011910 3300046512 Bacteria 5276
84 Ga0495616_0006824 3300046513 Bacteria 6878
85 Ga0495632_0128988 3300046519 Bacteria 1178
86 Ga0495652_0169025 3300046529 Bacteria 1690
87 Ga0495633_0035781 3300046558 Bacteria 2383
88 Ga0495668_0079410 3300046616 Bacteria 1801
89 Ga0495625_0000183 3300046660 Bacteria 98174
90 Ga0495661_0003387 3300046665 Bacteria 11796
91 Ga0495661_0003737 3300046665 Bacteria 11149
92 Ga0495661_0062687 3300046665 Bacteria 2201
93 Ga0495649_0000046 3300046694 Bacteria 120254
94 Ga0495660_0002367 3300046810 Bacteria 12053
95 Ga0495687_001728 3300047443 Bacteria 19328
96 Ga0501083_0013562 3300049744 Bacteria 5699
97 nmdc:mga0k408_16491_c1 3300050493 Bacteria 4100
98 nmdc:mga05p37_164593_c1 3300050507 Unclassified 2707
99 nmdc:mga05p37_45544_c1 3300050507 Bacteria 5394
100 nmdc:mga0a205_410653_c1 3300050515 Unclassified 1217
101 nmdc:mga0a205_563_c1 3300050515 Bacteria 29491
102 Ga0495601_0046428 3300053077 Bacteria 2734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042008 Ga0439450_032300 Ga0439450_032300_425_1159 243
2 3300042436 Ga0439435_0020254 Ga0439435_0020254_957_1691 243
3 3300041456 Ga0451795_0416862 Ga0451795_0416862_228_1004 255
4 3300025936 Ga0207670_10442630 Ga0207670_104426302 258
5 3300014969 Ga0157376_10102030 Ga0157376_101020302 260
6 3300026089 Ga0207648_10290494 Ga0207648_102904941 261
7 3300005841 Ga0068863_100024510 Ga0068863_1000245104 262
8 3300005539 Ga0068853_100202205 Ga0068853_1002022052 264
9 3300046810 Ga0495660_0002367 Ga0495660_0002367_10323_11192 267
10 3300021384 Ga0213876_10010075 Ga0213876_100100752 273
11 3300013307 Ga0157372_10132322 Ga0157372_101323224 274
12 3300025934 Ga0207686_10350953 Ga0207686_103509532 275
13 3300044712 Ga0453684_0026302 Ga0453684_0026302_2996_3832 275
14 3300005563 Ga0068855_100082149 Ga0068855_1000821491 276
15 3300028800 Ga0265338_10012873 Ga0265338_100128738 276
16 iso_pu_bacteria 2738543023 2739304344 276
17 iso_pu_bacteria 2919186247 2919188559 276
18 iso_pu_bacteria 2939664404 2939667286 276
19 iso_pu_bacteria 2977232053 2977234724 276
20 iso_pu_bacteria 8055588893 8055591529 276
21 3300013307 Ga0157372_10211345 Ga0157372_102113452 277
22 3300039437 Ga0436365_1931949 Ga0436365_1931949_14457_15317 277
23 3300002076 JGI24749J21850_1018720 JGI24749J21850_10187202 278
24 3300005288 Ga0065714_10096498 Ga0065714_100964982 278
25 3300005290 Ga0065712_10000744 Ga0065712_100007442 278
26 3300005327 Ga0070658_10000008 Ga0070658_1000000852 278
27 3300005354 Ga0070675_100169902 Ga0070675_1001699022 278
28 3300005365 Ga0070688_100008455 Ga0070688_1000084555 278
29 3300005440 Ga0070705_100028976 Ga0070705_1000289763 278
30 3300005457 Ga0070662_100069702 Ga0070662_1000697022 278
31 3300005466 Ga0070685_10012744 Ga0070685_100127442 278
32 3300005548 Ga0070665_100040145 Ga0070665_1000401458 278
33 3300005985 Ga0081539_10011883 Ga0081539_100118834 278
34 3300006844 Ga0075428_100002797 Ga0075428_10000279713 278
35 3300006846 Ga0075430_100017018 Ga0075430_1000170187 278
36 3300007076 Ga0075435_100015991 Ga0075435_1000159913 278
37 3300009094 Ga0111539_10363648 Ga0111539_103636482 278
38 3300009147 Ga0114129_10004742 Ga0114129_100047429 278
39 3300009147 Ga0114129_10175756 Ga0114129_101757563 278
40 3300009147 Ga0114129_10303085 Ga0114129_103030852 278
41 3300010375 Ga0105239_10085419 Ga0105239_100854192 278
42 3300013307 Ga0157372_10594391 Ga0157372_105943911 278
43 3300014325 Ga0163163_10019062 Ga0163163_100190627 278
44 3300025909 Ga0207705_10000026 Ga0207705_1000002652 278
45 3300025914 Ga0207671_10164508 Ga0207671_101645082 278
46 3300025949 Ga0207667_10628687 Ga0207667_106286871 278
47 3300027360 Ga0209969_1013228 Ga0209969_10132282 278
48 3300028786 Ga0307517_10001388 Ga0307517_1000138811 278
49 3300031548 Ga0307408_100263897 Ga0307408_1002638972 278
50 3300036401 Ga0373937_0349557 Ga0373937_0349557_463_1299 278
51 3300045049 Ga0466959_0184994 Ga0466959_0184994_194_1030 278
52 3300049744 Ga0501083_0013562 Ga0501083_0013562_305_1159 278
53 3300050507 nmdc:mga05p37_164593_c1 nmdc:mga05p37_164593_c1_917_1762 278
54 3300050507 nmdc:mga05p37_45544_c1 nmdc:mga05p37_45544_c1_1833_2672 278
55 3300050515 nmdc:mga0a205_410653_c1 nmdc:mga0a205_410653_c1_300_1145 278
56 3300050515 nmdc:mga0a205_563_c1 nmdc:mga0a205_563_c1_25387_26244 278
57 3300053077 Ga0495601_0046428 Ga0495601_0046428_465_1301 278
58 3300009093 Ga0105240_10982060 Ga0105240_109820601 279
59 3300014497 Ga0182008_10023610 Ga0182008_100236102 279
60 3300015262 Ga0182007_10026900 Ga0182007_100269002 279
61 3300046665 Ga0495661_0003387 Ga0495661_0003387_6712_7563 279
62 3300005288 Ga0065714_10002980 Ga0065714_100029808 280
63 3300005329 Ga0070683_100069200 Ga0070683_1000692002 280
64 3300013100 Ga0157373_10000327 Ga0157373_1000032717 280
65 3300013104 Ga0157370_10006731 Ga0157370_100067316 280
66 3300013105 Ga0157369_10145344 Ga0157369_101453443 280
67 3300013105 Ga0157369_10283123 Ga0157369_102831232 280
68 3300013307 Ga0157372_10000980 Ga0157372_1000098010 280
69 3300014497 Ga0182008_10133749 Ga0182008_101337491 280
70 3300025250 Ga0209026_1000246 Ga0209026_100024644 280
71 3300025944 Ga0207661_10068864 Ga0207661_100688643 280
72 3300031548 Ga0307408_100000487 Ga0307408_10000048715 280
73 3300031911 Ga0307412_10196224 Ga0307412_101962242 280
74 3300032004 Ga0307414_10001886 Ga0307414_100018862 280
75 iso_pu_bacteria 2932082852 2932088072 283
76 iso_pu_bacteria 2599185184 2599481744 284
77 iso_pu_bacteria 2928078545 2928082017 284
78 iso_pu_bacteria 2928147474 2928152037 284
79 3300001990 JGI24737J22298_10000852 JGI24737J22298_100008526 287
80 3300002067 JGI24735J21928_10000027 JGI24735J21928_1000002741 287
81 3300003316 rootH1_10031584 rootH1_100315848 287
82 3300013306 Ga0163162_10024448 Ga0163162_100244486 287
83 3300013307 Ga0157372_10000538 Ga0157372_100005384 287
84 3300037312 Ga0395899_0000237 Ga0395899_0000237_46711_47607 287
85 3300046507 Ga0495606_0000021 Ga0495606_0000021_226957_227859 287
86 3300046529 Ga0495652_0169025 Ga0495652_0169025_274_1176 287
87 3300001979 JGI24740J21852_10021757 JGI24740J21852_100217572 288
88 3300001989 JGI24739J22299_10001457 JGI24739J22299_100014574 288
89 3300005563 Ga0068855_100100474 Ga0068855_1001004744 288
90 3300006195 Ga0075366_10014581 Ga0075366_100145812 288
91 3300013100 Ga0157373_10000486 Ga0157373_1000048622 288
92 3300013102 Ga0157371_10001401 Ga0157371_1000140112 288
93 3300013105 Ga0157369_10000101 Ga0157369_1000010152 288
94 3300013307 Ga0157372_10000199 Ga0157372_1000019912 288
95 3300025949 Ga0207667_10120484 Ga0207667_101204842 288
96 3300037312 Ga0395899_0000024 Ga0395899_0000024_180267_181163 288
97 3300046471 Ga0495650_0000098 Ga0495650_0000098_161622_162491 288
98 3300046471 Ga0495650_0061083 Ga0495650_0061083_268_1137 288
99 3300046492 Ga0495585_0000308 Ga0495585_0000308_25126_25995 288
100 3300046507 Ga0495606_0006041 Ga0495606_0006041_9007_9876 288
101 3300046512 Ga0495610_0011910 Ga0495610_0011910_3597_4466 288
102 3300046513 Ga0495616_0006824 Ga0495616_0006824_5406_6275 288
103 3300046519 Ga0495632_0128988 Ga0495632_0128988_89_958 288
104 3300046558 Ga0495633_0035781 Ga0495633_0035781_939_1808 288
105 3300046616 Ga0495668_0079410 Ga0495668_0079410_547_1416 288
106 3300046660 Ga0495625_0000183 Ga0495625_0000183_48413_49282 288
107 3300046665 Ga0495661_0003737 Ga0495661_0003737_9392_10261 288
108 3300046665 Ga0495661_0062687 Ga0495661_0062687_667_1536 288
109 3300046694 Ga0495649_0000046 Ga0495649_0000046_48509_49378 288
110 3300047443 Ga0495687_001728 Ga0495687_001728_9236_10105 288
111 3300050493 nmdc:mga0k408_16491_c1 nmdc:mga0k408_16491_c1_2054_2923 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02621

VitK2_biosynth

Menaquinone biosynthesis

3

286

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2czl-assembly1.cif.gz_A crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) 0.9652 3 287
2czl-assembly1.cif.gz_A crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) 0.9582 3 287
1zbm-assembly1.cif.gz_A x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. 0.9547 2 278
1zbm-assembly1.cif.gz_A x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. 0.9372 2 278
7an8-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.801 1 288
ID Description Score Start End Superfamily
2dbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9515 3 287 3.40.190.10
2dbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.941 3 287 3.40.190.10
1zbmA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.934 2 278 3.40.190.10
1zbmA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.907 2 278 3.40.190.10
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8767 80 185 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6L8UK52-F1-model_v4 1,4-dihydroxy-6-naphtoate synthase (EC 4.1.99.29) (Menaquinone biosynthetic enzyme MqnD) 0.9839 1 288 GO:0009234
GO:0016830
AF-A0A2V5NKG7-F1-model_v4 ABC transporter substrate-binding protein 0.9816 1 84 GO:0009234
GO:0016829
AF-A0A6L8UK52-F1-model_v4 1,4-dihydroxy-6-naphtoate synthase (EC 4.1.99.29) (Menaquinone biosynthetic enzyme MqnD) 0.9804 1 288 GO:0009234
GO:0016830
AF-A0A520HGY5-F1-model_v4 1,4-dihydroxy-6-naphthoate synthase 0.9795 146 288 GO:0009234
GO:0016829
AF-A0A7C6AWX8-F1-model_v4 1,4-dihydroxy-6-naphthoate synthase 0.9789 25 288 GO:0009234
GO:0016830

Feature Viewer

pLDDT pTM Quality
93.75 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map