F046008

General Info

Members Datasets Scaffolds Average Seq Length
107 87 96 299

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2909042592|2909043822
Length 325
Sequence GRVEIFEVGPRDGLQNESRVLPVETRIAMIRDLAAAGLRTVEAGSFVSPRNLPQMAGTAEVLAGLSGLTRPSFSGESISRSTSDGTQRGDLEIDPPNLINLPVLVPNARGFADALAAKARHIAVFAAASESFSRRNINRGIEESLAEYRPIVAGALAAGLKVRGYVSCVLGCPYEGHVPVSAVVSVATALASMGCQEISLGDTIGVGTPDAARAMTAAVASEIGIQRVAVHFHDTYGQALANVLACLELGVTVVDSSVAGLGGCPYAPGASGNLATEDLVYMLEGLGVETGVDLDRVAAAGRTVCAALGAAPRSRTGQALAAKIK

Samples

Sample ID Description Type Environment
1 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
2 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
3 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
4 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
5 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
6 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
7 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
8 2909042592 Labrys sp. LIt4 Isolate Nodule
9 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
10 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
33 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
34 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
49 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
50 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
60 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
61 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
65 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
66 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
67 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
68 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
69 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
70 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
71 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
75 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
76 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
77 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
78 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
80 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
81 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
82 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
83 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
84 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
85 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
86 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
87 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.72
Metatranscriptomes 0
Isolates 10.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.67
Nodule 1.87
Rhizoplane 0.93
Rhizosphere 85.05
Stem 0
Stem Tuber 0
Unclassified 7.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10030256 3300003323 Bacteria 3192
2 Ga0070689_100105038 3300005340 Bacteria 2240
3 Ga0070692_10018320 3300005345 Bacteria 3365
4 Ga0070669_100080289 3300005353 Bacteria 2428
5 Ga0070671_100081110 3300005355 Bacteria 2713
6 Ga0070671_100164208 3300005355 Bacteria 1877
7 Ga0070673_100050373 3300005364 Bacteria 3256
8 Ga0070673_100051408 3300005364 Bacteria 3227
9 Ga0070688_100382097 3300005365 Bacteria 1038
10 Ga0070667_100071988 3300005367 Bacteria 2945
11 Ga0070713_100162015 3300005436 Bacteria 1997
12 Ga0070678_100325251 3300005456 Bacteria 1314
13 Ga0070662_100090611 3300005457 Bacteria 2296
14 Ga0070679_100216308 3300005530 Bacteria 1878
15 Ga0070672_100018694 3300005543 Bacteria 5017
16 Ga0070665_100039554 3300005548 Bacteria 4741
17 Ga0075369_10095622 3300006186 Bacteria 1329
18 Ga0075428_100003254 3300006844 Bacteria 17782
19 Ga0075428_100010445 3300006844 Bacteria 10311
20 Ga0075431_100168124 3300006847 Bacteria 2254
21 Ga0111539_10204247 3300009094 Bacteria 2303
22 Ga0105248_10116841 3300009177 Bacteria 3008
23 Ga0163162_10120440 3300013306 Bacteria 2728
24 Ga0163162_10175745 3300013306 Bacteria 2267
25 Ga0157375_10073571 3300013308 Bacteria 3437
26 Ga0213872_10000192 3300021361 Bacteria 54234
27 Ga0213872_10001936 3300021361 Bacteria 12647
28 Ga0213872_10003005 3300021361 Bacteria 9532
29 Ga0213872_10004837 3300021361 Bacteria 7031
30 Ga0213872_10042469 3300021361 Bacteria 2073
31 Ga0213871_10000787 3300021441 Bacteria 4716
32 Ga0213871_10025773 3300021441 Bacteria 1500
33 Ga0207657_10422667 3300025919 Bacteria 1047
34 Ga0207681_10050031 3300025923 Bacteria 2827
35 Ga0207681_10211364 3300025923 Bacteria 1495
36 Ga0207644_10037876 3300025931 Bacteria 3394
37 Ga0207644_10075533 3300025931 Bacteria 2476
38 Ga0207670_10556689 3300025936 Bacteria 938
39 Ga0207691_10046034 3300025940 Bacteria 4011
40 Ga0207711_10012608 3300025941 Bacteria 7021
41 Ga0207658_10088638 3300025986 Bacteria 2393
42 Ga0207675_100204611 3300026118 Bacteria 1897
43 Ga0207683_10321282 3300026121 Bacteria 1418
44 Ga0268265_10152520 3300028380 Bacteria 1951
45 Ga0265338_10224002 3300028800 Bacteria 1403
46 Ga0265332_10010517 3300031238 Bacteria 4120
47 Ga0265325_10000744 3300031241 Bacteria 23548
48 Ga0265327_10001002 3300031251 Bacteria 40040
49 Ga0307508_10042486 3300031616 Bacteria 4078
50 Ga0307508_10325076 3300031616 Bacteria 1130
51 Ga0373931_0021366 3300035691 Bacteria 3247
52 Ga0373927_0326241 3300035695 Unclassified 1011
53 Ga0436364_0559739 3300037853 Unclassified 2441
54 Ga0436365_0479531 3300039437 Bacteria 1048
55 Ga0436360_0735670 3300039438 Bacteria 1910
56 Ga0436360_0757770 3300039438 Bacteria 4059
57 Ga0436361_0202986 3300039447 Bacteria 20420
58 Ga0436361_0350386 3300039447 Bacteria 47576
59 Ga0436361_0873357 3300039447 Bacteria 40424
60 Ga0436361_1102869 3300039447 Bacteria 7803
61 Ga0436361_1185766 3300039447 Bacteria 5271
62 Ga0466965_0008473 3300044683 Bacteria 4758
63 Ga0466966_0003769 3300044684 Bacteria 9997
64 Ga0466961_0004408 3300044693 Bacteria 8810
65 Ga0466963_0235233 3300044694 Bacteria 1284
66 Ga0466964_0067023 3300044706 Bacteria 1508
67 Ga0453684_0000386 3300044712 Bacteria 180948
68 Ga0466957_0111087 3300044842 Bacteria 1738
69 Ga0466959_0044562 3300045049 Bacteria 3269
70 Ga0466959_0051320 3300045049 Bacteria 3025
71 Ga0466958_0000250 3300045836 Bacteria 20747
72 Ga0495650_0020110 3300046471 Bacteria 3264
73 Ga0495583_0001712 3300046506 Bacteria 21080
74 Ga0495654_0000106 3300046530 Bacteria 94076
75 Ga0495654_0001680 3300046530 Bacteria 14901
76 Ga0495645_0252739 3300046543 Bacteria 1171
77 Ga0495667_0048969 3300046559 Bacteria 2790
78 Ga0495602_0197981 3300048088 Bacteria 1535
79 Ga0496118_0157430 3300048921 Bacteria 1411
80 Ga0496122_0019849 3300048925 Bacteria 6115
81 Ga0501034_0000456 3300049571 Bacteria 67493
82 Ga0501034_0098511 3300049571 Bacteria 2919
83 Ga0501047_0069335 3300049581 Bacteria 3396
84 Ga0501070_0052470 3300049586 Bacteria 3385
85 Ga0501072_0000512 3300049588 Bacteria 27850
86 Ga0501074_0322715 3300049590 Bacteria 1096
87 Ga0501076_0053867 3300049592 Bacteria 3189
88 Ga0501035_0157170 3300049822 Bacteria 1970
89 Ga0501045_0145123 3300049824 Bacteria 1765
90 nmdc:mga0k408_9542_c1 3300050493 Bacteria 5235
91 nmdc:mga06r32_170320_c1 3300050510 Bacteria 2161
92 nmdc:mga08y16_388312_c1 3300050511 Bacteria 1430
93 Ga0495595_0069595 3300053084 Bacteria 1662
94 Ga0500566_0010575 3300053094 Bacteria 5438
95 Ga0500618_000984 3300053125 Bacteria 14421
96 Ga0500634_0041020 3300053161 Bacteria 2514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100003254 Ga0075428_1000032543 265
2 3300006847 Ga0075431_100168124 Ga0075431_1001681241 265
3 3300009094 Ga0111539_10204247 Ga0111539_102042472 265
4 3300050510 nmdc:mga06r32_170320_c1 nmdc:mga06r32_170320_c1_146_1087 266
5 3300050511 nmdc:mga08y16_388312_c1 nmdc:mga08y16_388312_c1_358_1299 266
6 3300005355 Ga0070671_100164208 Ga0070671_1001642082 272
7 3300005364 Ga0070673_100050373 Ga0070673_1000503734 272
8 3300025931 Ga0207644_10037876 Ga0207644_100378763 272
9 3300031616 Ga0307508_10042486 Ga0307508_100424863 272
10 3300037853 Ga0436364_0559739 Ga0436364_0559739_805_1647 280
11 3300046543 Ga0495645_0252739 Ga0495645_0252739_16_867 283
12 iso_pu_bacteria 2941499720 2941504322 285
13 3300031238 Ga0265332_10010517 Ga0265332_100105173 286
14 3300021361 Ga0213872_10000192 Ga0213872_1000019239 290
15 3300039447 Ga0436361_0350386 Ga0436361_0350386_31246_32160 290
16 3300049586 Ga0501070_0052470 Ga0501070_0052470_2476_3357 293
17 iso_pu_bacteria 2846033681 2846035724 293
18 iso_pu_bacteria 2513237087 2513590144 294
19 iso_pu_bacteria 8056161164 8056166610 294
20 3300045049 Ga0466959_0044562 Ga0466959_0044562_97_984 295
21 3300021361 Ga0213872_10001936 Ga0213872_100019367 296
22 3300044842 Ga0466957_0111087 Ga0466957_0111087_512_1402 296
23 iso_pu_bacteria 2554235003 2554249367 296
24 iso_pu_bacteria 2599185236 2599724086 296
25 3300028800 Ga0265338_10224002 Ga0265338_102240022 297
26 3300039438 Ga0436360_0757770 Ga0436360_0757770_1297_2190 297
27 3300045836 Ga0466958_0000250 Ga0466958_0000250_10385_11278 297
28 iso_pu_bacteria 2909042592 2909043822 297
29 3300021361 Ga0213872_10004837 Ga0213872_100048376 298
30 3300039437 Ga0436365_0479531 Ga0436365_0479531_75_977 298
31 3300039447 Ga0436361_0873357 Ga0436361_0873357_7398_8297 298
32 3300039447 Ga0436361_1102869 Ga0436361_1102869_2952_3848 298
33 3300044683 Ga0466965_0008473 Ga0466965_0008473_2879_3775 298
34 3300044684 Ga0466966_0003769 Ga0466966_0003769_273_1169 298
35 3300044693 Ga0466961_0004408 Ga0466961_0004408_6811_7707 298
36 3300044706 Ga0466964_0067023 Ga0466964_0067023_541_1437 298
37 3300045049 Ga0466959_0051320 Ga0466959_0051320_1518_2414 298
38 3300046506 Ga0495583_0001712 Ga0495583_0001712_16071_16967 298
39 3300046530 Ga0495654_0000106 Ga0495654_0000106_77179_78075 298
40 3300046530 Ga0495654_0001680 Ga0495654_0001680_5927_6823 298
41 3300053125 Ga0500618_000984 Ga0500618_000984_4295_5191 298
42 iso_pu_bacteria 2954011201 2954012726 298
43 iso_pu_bacteria 2547132103 2547371215 299
44 3300021361 Ga0213872_10042469 Ga0213872_100424691 300
45 3300049581 Ga0501047_0069335 Ga0501047_0069335_876_1793 300
46 3300049822 Ga0501035_0157170 Ga0501035_0157170_166_1083 300
47 3300005340 Ga0070689_100105038 Ga0070689_1001050382 301
48 3300005530 Ga0070679_100216308 Ga0070679_1002163082 301
49 3300005548 Ga0070665_100039554 Ga0070665_1000395543 301
50 3300021441 Ga0213871_10000787 Ga0213871_100007874 301
51 3300021441 Ga0213871_10025773 Ga0213871_100257731 301
52 3300035695 Ga0373927_0326241 Ga0373927_0326241_68_976 301
53 3300039438 Ga0436360_0735670 Ga0436360_0735670_395_1300 301
54 3300039447 Ga0436361_1185766 Ga0436361_1185766_667_1572 301
55 3300048921 Ga0496118_0157430 Ga0496118_0157430_317_1225 301
56 3300048925 Ga0496122_0019849 Ga0496122_0019849_1856_2764 301
57 3300005353 Ga0070669_100080289 Ga0070669_1000802892 302
58 3300005355 Ga0070671_100081110 Ga0070671_1000811101 302
59 3300005364 Ga0070673_100051408 Ga0070673_1000514082 302
60 3300005365 Ga0070688_100382097 Ga0070688_1003820971 302
61 3300005367 Ga0070667_100071988 Ga0070667_1000719883 302
62 3300005456 Ga0070678_100325251 Ga0070678_1003252512 302
63 3300005457 Ga0070662_100090611 Ga0070662_1000906112 302
64 3300005543 Ga0070672_100018694 Ga0070672_1000186942 302
65 3300009177 Ga0105248_10116841 Ga0105248_101168412 302
66 3300013306 Ga0163162_10175745 Ga0163162_101757452 302
67 3300013308 Ga0157375_10073571 Ga0157375_100735714 302
68 3300021361 Ga0213872_10003005 Ga0213872_100030054 302
69 3300025923 Ga0207681_10211364 Ga0207681_102113641 302
70 3300025931 Ga0207644_10075533 Ga0207644_100755333 302
71 3300025936 Ga0207670_10556689 Ga0207670_105566891 302
72 3300025940 Ga0207691_10046034 Ga0207691_100460342 302
73 3300025941 Ga0207711_10012608 Ga0207711_100126082 302
74 3300025986 Ga0207658_10088638 Ga0207658_100886383 302
75 3300026118 Ga0207675_100204611 Ga0207675_1002046112 302
76 3300026121 Ga0207683_10321282 Ga0207683_103212822 302
77 3300028380 Ga0268265_10152520 Ga0268265_101525202 302
78 3300039447 Ga0436361_0202986 Ga0436361_0202986_14927_15835 302
79 3300050493 nmdc:mga0k408_9542_c1 nmdc:mga0k408_9542_c1_2491_3426 302
80 3300053094 Ga0500566_0010575 Ga0500566_0010575_1278_2186 302
81 3300044694 Ga0466963_0235233 Ga0466963_0235233_345_1271 303
82 3300046471 Ga0495650_0020110 Ga0495650_0020110_1169_2080 303
83 iso_pu_bacteria 2883291878 2883294788 303
84 3300013306 Ga0163162_10120440 Ga0163162_101204402 304
85 3300031251 Ga0265327_10001002 Ga0265327_1000100228 304
86 3300044712 Ga0453684_0000386 Ga0453684_0000386_120371_121297 304
87 3300049571 Ga0501034_0000456 Ga0501034_0000456_54978_55892 304
88 3300049588 Ga0501072_0000512 Ga0501072_0000512_24802_25716 304
89 3300049590 Ga0501074_0322715 Ga0501074_0322715_51_965 304
90 3300053161 Ga0500634_0041020 Ga0500634_0041020_1006_1920 304
91 3300005345 Ga0070692_10018320 Ga0070692_100183203 305
92 3300006844 Ga0075428_100010445 Ga0075428_1000104457 305
93 3300031241 Ga0265325_10000744 Ga0265325_1000074415 305
94 3300048088 Ga0495602_0197981 Ga0495602_0197981_449_1387 306
95 3300049571 Ga0501034_0098511 Ga0501034_0098511_899_1819 306
96 3300049592 Ga0501076_0053867 Ga0501076_0053867_786_1724 306
97 3300049824 Ga0501045_0145123 Ga0501045_0145123_456_1376 306
98 3300006186 Ga0075369_10095622 Ga0075369_100956222 307
99 iso_pu_bacteria 2828305725 2828308574 307
100 3300025919 Ga0207657_10422667 Ga0207657_104226671 308
101 3300035691 Ga0373931_0021366 Ga0373931_0021366_1158_2084 308
102 3300003323 rootH1_10030256 rootH1_100302565 309
103 3300005436 Ga0070713_100162015 Ga0070713_1001620152 309
104 3300025923 Ga0207681_10050031 Ga0207681_100500312 309
105 3300031616 Ga0307508_10325076 Ga0307508_103250761 309
106 3300046559 Ga0495667_0048969 Ga0495667_0048969_1745_2674 309
107 3300053084 Ga0495595_0069595 Ga0495595_0069595_54_983 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00682

HMGL-like

HMGL-like

2

304

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mp4-assembly3.cif.gz_F crystal structure of human lyase r41m mutant 0.9924 2 296
2cw6-assembly3.cif.gz_F crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria 0.9918 2 295
2cw6-assembly1.cif.gz_A crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria 0.9916 2 296
3mp5-assembly2.cif.gz_C crystal structure of human lyase r41m in complex with hmg-coa 0.9916 2 295
2cw6-assembly2.cif.gz_D crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria 0.9914 2 295
ID Description Score Start End Superfamily
af_Q0JNR8_151_451_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.991 3 296 3.20.20.70
1ydoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9794 2 298 3.20.20.70
1ydoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9761 2 298 3.20.20.70
af_Q0JNR8_151_451_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9649 3 296 3.20.20.70
af_Q4DFZ0_10_135_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9235 7 124 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0D2VKT3-F1-model_v4 hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4) 1 2 186 GO:0004419
GO:0006552
GO:0046872
GO:0046951
AF-U3J1A6-F1-model_v4 Hydroxymethylglutaryl-CoA lyase, mitochondrial (EC 3.2.1.51) (EC 4.1.3.4) (3-hydroxy-3-methylglutarate-CoA lyase) 0.999 2 295 GO:0004419
GO:0004560
GO:0005759
GO:0005777
GO:0006004
GO:0006552
GO:0046872
GO:0046951
AF-A0A7S2C770-F1-model_v4 hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4) 0.9986 1 185 GO:0004419
GO:0006552
GO:0046872
GO:0046951
AF-A0A3M0IRS8-F1-model_v4 Hydroxymethylglutaryl-CoA lyase, mitochondrial (EC 3.2.1.51) (EC 4.1.3.4) (EC 5.1.3.7) (3-hydroxy-3-methylglutarate-CoA lyase) (UDP-N-acetylglucosamine 4-epimerase) 0.9982 2 294 GO:0003974
GO:0003978
GO:0004419
GO:0004560
GO:0005759
GO:0005777
GO:0006004
GO:0006012
GO:0006552
GO:0046872
GO:0046951
AF-A0A493TCQ7-F1-model_v4 Hydroxymethylglutaryl-CoA lyase, mitochondrial (EC 3.2.1.51) (EC 4.1.3.4) (3-hydroxy-3-methylglutarate-CoA lyase) 0.9982 2 294 GO:0004419
GO:0004560
GO:0005759
GO:0005777
GO:0006004
GO:0006552
GO:0046872
GO:0046951

Feature Viewer

pLDDT pTM Quality
93.72 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map