F044080

General Info

Members Datasets Scaffolds Average Seq Length
107 24 106 289

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10005523|Ga0316575_100055232
Length 333
Sequence VFIETSAGTNRCVLDYLRSITCPNLQLPVQSVYDHFGKVATKLLGRKGRNLVTKTERNALIALPIVILXXXGVALAGSQGGASAAGIPIFALCVGLAFLIQWLAFIPAYLLQTEKFLDLTGSLTYITVAAIAVLLSPVVDGRSILLLALVVIWAARLGIFLFRRIQRTGKDSRFDQIKPSFIRFLSFWTLQGLWVTFTAELGLFALIGFLVWAFGFVMETVADVQKNRFRAGPKNKGKFIDSGVWAWSRHPNYFGEIVLWIGVAIIALPVLRGWQWATLISPVFVALLLTRISGVPMLEKRADEKWGGQEDYEAYKKRTPVLIPRPRFSSDGK

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
3 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
4 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
5 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
6 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
7 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
8 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
9 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
10 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
11 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
15 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
16 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
17 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
18 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
19 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
20 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
21 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
22 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
23 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
24 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 3.74
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.26
Stem 0
Stem Tuber 0
Unclassified 3.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10327106 3300031344 Bacteria 1113
2 Ga0307408_100001583 3300031548 Bacteria 16796
3 Ga0316575_10003817 3300031665 Bacteria 5249
4 Ga0316575_10005523 3300031665 Bacteria 4512
5 Ga0316575_10040304 3300031665 Unclassified 1845
6 Ga0316579_10013574 3300031691 Bacteria 3506
7 Ga0316579_10020284 3300031691 Unclassified 2947
8 Ga0316579_10035881 3300031691 Bacteria 2286
9 Ga0316579_10058948 3300031691 Bacteria 1804
10 Ga0316579_10060949 3300031691 Bacteria 1775
11 Ga0316579_10126304 3300031691 Bacteria 1231
12 Ga0316576_10036603 3300031727 Bacteria 3508
13 Ga0316576_10046016 3300031727 Unclassified 3157
14 Ga0316576_10092728 3300031727 Bacteria 2251
15 Ga0316576_10121994 3300031727 Unclassified 1958
16 Ga0316576_10136408 3300031727 Bacteria 1847
17 Ga0316578_10072891 3300031728 Unclassified 2034
18 Ga0316578_10205930 3300031728 Bacteria 1184
19 Ga0316577_10000542 3300031733 Bacteria 15263
20 Ga0316577_10001072 3300031733 Bacteria 12382
21 Ga0316577_10004884 3300031733 Bacteria 6979
22 Ga0316577_10013602 3300031733 Bacteria 4455
23 Ga0316577_10017856 3300031733 Unclassified 3921
24 Ga0316577_10020027 3300031733 Bacteria 3706
25 Ga0316577_10026351 3300031733 Bacteria 3237
26 Ga0316577_10028942 3300031733 Bacteria 3092
27 Ga0316577_10107782 3300031733 Bacteria 1563
28 Ga0316577_10113939 3300031733 Unclassified 1517
29 Ga0307412_10001890 3300031911 Bacteria 11589
30 Ga0316585_10006709 3300032137 Bacteria 3296
31 Ga0316585_10043228 3300032137 Unclassified 1438
32 Ga0316580_10007122 3300032139 Bacteria 3321
33 Ga0316580_10061753 3300032139 Bacteria 1150
34 Ga0316593_10012081 3300032168 Unclassified 2527
35 Ga0316593_10014313 3300032168 Bacteria 2363
36 Ga0316587_1000383 3300033529 Bacteria 4304
37 Ga0316596_1011303 3300033541 Bacteria 2179
38 Ga0316574_0008327 3300035398 Bacteria 5753
39 Ga0316574_0012485 3300035398 Bacteria 4860
40 Ga0316574_0064234 3300035398 Unclassified 2309
41 Ga0316574_0068387 3300035398 Bacteria 2240
42 Ga0316582_0001802 3300036647 Bacteria 9671
43 Ga0316582_0012057 3300036647 Bacteria 4810
44 Ga0316582_0036563 3300036647 Bacteria 3040
45 Ga0316582_0051078 3300036647 Bacteria 2622
46 Ga0316582_0065281 3300036647 Bacteria 2343
47 Ga0316582_0110899 3300036647 Bacteria 1826
48 Ga0316582_0111587 3300036647 Bacteria 1821
49 Ga0316582_0258029 3300036647 Bacteria 1195
50 Ga0316582_0370777 3300036647 Bacteria 985
51 Ga0316584_0003113 3300036712 Bacteria 10715
52 Ga0316584_0034796 3300036712 Bacteria 3735
53 Ga0316584_0043181 3300036712 Bacteria 3361
54 Ga0316584_0047295 3300036712 Bacteria 3214
55 Ga0316584_0097970 3300036712 Bacteria 2195
56 Ga0316584_0133447 3300036712 Bacteria 1854
57 Ga0316584_0152767 3300036712 Unclassified 1718
58 Ga0316584_0198803 3300036712 Bacteria 1480
59 Ga0316584_0261008 3300036712 Bacteria 1263
60 Ga0316584_0335220 3300036712 Unclassified 1088
61 Ga0316584_0363040 3300036712 Bacteria 1038
62 Ga0316584_0394122 3300036712 Bacteria 987
63 Ga0316581_0010877 3300037588 Bacteria 2533
64 Ga0316581_0019362 3300037588 Bacteria 1984
65 Ga0316581_0064556 3300037588 Bacteria 1124
66 Ga0400484_23185 3300038725 Bacteria 1094
67 Ga0400489_41191 3300039093 Bacteria 8731
68 Ga0400489_60604 3300039093 Bacteria 3847
69 Ga0400489_71322 3300039093 Bacteria 2476
70 Ga0451577_0008215 3300042876 Bacteria 10174
71 Ga0451577_0010271 3300042876 Bacteria 8963
72 Ga0451577_0132452 3300042876 Bacteria 2237
73 Ga0451577_0457539 3300042876 Bacteria 1159
74 Ga0453683_0000747 3300044673 Bacteria 32801
75 Ga0453683_0009711 3300044673 Bacteria 6415
76 Ga0453683_0010666 3300044673 Bacteria 6085
77 Ga0453683_0076256 3300044673 Unclassified 2099
78 Ga0453683_0139868 3300044673 Unclassified 1527
79 Ga0453684_0000344 3300044712 Bacteria 192860
80 Ga0453684_0000859 3300044712 Bacteria 102253
81 Ga0453684_0001674 3300044712 Bacteria 59980
82 Ga0453684_0002098 3300044712 Bacteria 50342
83 Ga0453684_0005094 3300044712 Bacteria 26501
84 Ga0453684_0006513 3300044712 Bacteria 22129
85 Ga0453684_0016694 3300044712 Bacteria 11451
86 Ga0453684_0024120 3300044712 Bacteria 8910
87 Ga0453684_0025455 3300044712 Bacteria 8591
88 Ga0453684_0028829 3300044712 Bacteria 7903
89 Ga0453684_0032190 3300044712 Bacteria 7347
90 Ga0453684_0036314 3300044712 Bacteria 6792
91 Ga0453684_0039962 3300044712 Bacteria 6380
92 Ga0453684_0058453 3300044712 Bacteria 4981
93 Ga0453684_0122617 3300044712 Bacteria 3135
94 Ga0453684_0196189 3300044712 Unclassified 2357
95 Ga0453684_0197041 3300044712 Bacteria 2351
96 Ga0453684_0202533 3300044712 Unclassified 2313
97 Ga0453684_0231584 3300044712 Bacteria 2132
98 Ga0453684_0259777 3300044712 Bacteria 1990
99 Ga0453684_0320371 3300044712 Unclassified 1756
100 Ga0453684_0388828 3300044712 Bacteria 1565
101 Ga0453684_0437796 3300044712 Bacteria 1457
102 Ga0453684_0444354 3300044712 Bacteria 1444
103 Ga0453684_0766246 3300044712 Bacteria 1043
104 Ga0451576_0000009 3300045051 Bacteria 712666
105 Ga0451576_0004888 3300045051 Bacteria 17124
106 Ga0451576_0043411 3300045051 Bacteria 4744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0320371 Ga0453684_0320371_994_1728 244
2 3300044712 Ga0453684_0388828 Ga0453684_0388828_41_781 246
3 3300036647 Ga0316582_0370777 Ga0316582_0370777_35_790 251
4 3300038725 Ga0400484_23185 Ga0400484_23185_305_1072 255
5 3300037588 Ga0316581_0064556 Ga0316581_0064556_39_842 258
6 3300031727 Ga0316576_10036603 Ga0316576_100366031 259
7 3300032137 Ga0316585_10006709 Ga0316585_100067092 259
8 3300032139 Ga0316580_10007122 Ga0316580_100071225 259
9 3300033529 Ga0316587_1000383 Ga0316587_10003837 259
10 3300036712 Ga0316584_0394122 Ga0316584_0394122_83_967 259
11 3300031548 Ga0307408_100001583 Ga0307408_10000158312 266
12 3300031665 Ga0316575_10005523 Ga0316575_100055232 266
13 3300031691 Ga0316579_10013574 Ga0316579_100135742 266
14 3300031733 Ga0316577_10013602 Ga0316577_100136022 266
15 3300031911 Ga0307412_10001890 Ga0307412_100018905 266
16 3300035398 Ga0316574_0068387 Ga0316574_0068387_366_1406 266
17 3300036647 Ga0316582_0051078 Ga0316582_0051078_1090_2130 266
18 3300037588 Ga0316581_0019362 Ga0316581_0019362_922_1962 266
19 3300036712 Ga0316584_0363040 Ga0316584_0363040_29_880 267
20 3300039093 Ga0400489_60604 Ga0400489_60604_2057_2863 267
21 3300044712 Ga0453684_0202533 Ga0453684_0202533_359_1240 268
22 3300042876 Ga0451577_0457539 Ga0451577_0457539_80_937 269
23 3300031691 Ga0316579_10020284 Ga0316579_100202842 272
24 3300031733 Ga0316577_10001072 Ga0316577_1000107210 272
25 3300039093 Ga0400489_41191 Ga0400489_41191_5768_6634 272
26 3300042876 Ga0451577_0008215 Ga0451577_0008215_5902_6768 272
27 3300042876 Ga0451577_0010271 Ga0451577_0010271_589_1455 272
28 3300042876 Ga0451577_0132452 Ga0451577_0132452_578_1444 272
29 3300044673 Ga0453683_0000747 Ga0453683_0000747_3087_3983 272
30 3300044673 Ga0453683_0009711 Ga0453683_0009711_5514_6380 272
31 3300044673 Ga0453683_0076256 Ga0453683_0076256_1023_1889 272
32 3300044712 Ga0453684_0000344 Ga0453684_0000344_133895_134761 272
33 3300044712 Ga0453684_0000859 Ga0453684_0000859_30855_31721 272
34 3300044712 Ga0453684_0002098 Ga0453684_0002098_2485_3351 272
35 3300044712 Ga0453684_0005094 Ga0453684_0005094_21786_22652 272
36 3300044712 Ga0453684_0006513 Ga0453684_0006513_16531_17397 272
37 3300044712 Ga0453684_0016694 Ga0453684_0016694_6824_7690 272
38 3300044712 Ga0453684_0025455 Ga0453684_0025455_2374_3240 272
39 3300044712 Ga0453684_0028829 Ga0453684_0028829_4138_5004 272
40 3300044712 Ga0453684_0032190 Ga0453684_0032190_1207_2073 272
41 3300044712 Ga0453684_0036314 Ga0453684_0036314_5772_6638 272
42 3300044712 Ga0453684_0196189 Ga0453684_0196189_931_1797 272
43 3300044712 Ga0453684_0197041 Ga0453684_0197041_498_1364 272
44 3300044712 Ga0453684_0231584 Ga0453684_0231584_420_1286 272
45 3300044712 Ga0453684_0259777 Ga0453684_0259777_212_1078 272
46 3300044712 Ga0453684_0437796 Ga0453684_0437796_470_1336 272
47 3300044712 Ga0453684_0766246 Ga0453684_0766246_26_892 272
48 3300045051 Ga0451576_0000009 Ga0451576_0000009_361967_362833 272
49 3300045051 Ga0451576_0004888 Ga0451576_0004888_6538_7434 272
50 3300031691 Ga0316579_10058948 Ga0316579_100589481 273
51 3300031691 Ga0316579_10060949 Ga0316579_100609491 273
52 3300031733 Ga0316577_10020027 Ga0316577_100200273 273
53 3300032139 Ga0316580_10061753 Ga0316580_100617531 273
54 3300036647 Ga0316582_0065281 Ga0316582_0065281_120_1010 273
55 3300036647 Ga0316582_0111587 Ga0316582_0111587_849_1718 273
56 3300036712 Ga0316584_0043181 Ga0316584_0043181_1066_1956 273
57 3300036712 Ga0316584_0198803 Ga0316584_0198803_256_1125 273
58 3300044712 Ga0453684_0001674 Ga0453684_0001674_8990_9859 273
59 3300044712 Ga0453684_0024120 Ga0453684_0024120_2759_3706 273
60 3300031665 Ga0316575_10040304 Ga0316575_100403044 274
61 3300031691 Ga0316579_10035881 Ga0316579_100358813 274
62 3300031733 Ga0316577_10028942 Ga0316577_100289423 274
63 3300035398 Ga0316574_0064234 Ga0316574_0064234_661_1533 274
64 3300044673 Ga0453683_0010666 Ga0453683_0010666_4479_5351 274
65 3300044712 Ga0453684_0122617 Ga0453684_0122617_1138_2010 274
66 3300045051 Ga0451576_0043411 Ga0451576_0043411_3019_3891 274
67 3300031727 Ga0316576_10136408 Ga0316576_101364081 275
68 3300033541 Ga0316596_1011303 Ga0316596_10113032 275
69 3300044673 Ga0453683_0139868 Ga0453683_0139868_125_1000 275
70 3300044712 Ga0453684_0039962 Ga0453684_0039962_4556_5431 275
71 3300044712 Ga0453684_0058453 Ga0453684_0058453_756_1631 275
72 3300044712 Ga0453684_0444354 Ga0453684_0444354_331_1206 275
73 3300031727 Ga0316576_10092728 Ga0316576_100927281 276
74 3300031728 Ga0316578_10205930 Ga0316578_102059302 276
75 3300032168 Ga0316593_10012081 Ga0316593_100120813 276
76 3300031665 Ga0316575_10003817 Ga0316575_100038173 277
77 3300031727 Ga0316576_10046016 Ga0316576_100460162 277
78 3300031727 Ga0316576_10121994 Ga0316576_101219942 277
79 3300031728 Ga0316578_10072891 Ga0316578_100728912 277
80 3300031733 Ga0316577_10000542 Ga0316577_100005427 277
81 3300031733 Ga0316577_10017856 Ga0316577_100178564 277
82 3300031733 Ga0316577_10113939 Ga0316577_101139391 277
83 3300032137 Ga0316585_10043228 Ga0316585_100432281 277
84 3300032168 Ga0316593_10014313 Ga0316593_100143133 277
85 3300035398 Ga0316574_0008327 Ga0316574_0008327_2508_3389 277
86 3300035398 Ga0316574_0012485 Ga0316574_0012485_2210_3091 277
87 3300036647 Ga0316582_0001802 Ga0316582_0001802_4801_5682 277
88 3300036647 Ga0316582_0036563 Ga0316582_0036563_1927_2808 277
89 3300036712 Ga0316584_0003113 Ga0316584_0003113_6530_7411 277
90 3300036712 Ga0316584_0034796 Ga0316584_0034796_394_1275 277
91 3300036712 Ga0316584_0097970 Ga0316584_0097970_624_1505 277
92 3300036712 Ga0316584_0133447 Ga0316584_0133447_607_1488 277
93 iso_pu_bacteria 8055037949 8055040374 277
94 3300031691 Ga0316579_10126304 Ga0316579_101263041 278
95 3300031733 Ga0316577_10107782 Ga0316577_101077822 278
96 3300036647 Ga0316582_0258029 Ga0316582_0258029_70_954 278
97 3300036712 Ga0316584_0152767 Ga0316584_0152767_463_1347 278
98 3300036712 Ga0316584_0261008 Ga0316584_0261008_209_1093 278
99 3300036712 Ga0316584_0335220 Ga0316584_0335220_113_997 278
100 3300037588 Ga0316581_0010877 Ga0316581_0010877_216_1100 278
101 3300031733 Ga0316577_10004884 Ga0316577_100048846 279
102 3300031733 Ga0316577_10026351 Ga0316577_100263515 279
103 3300036647 Ga0316582_0110899 Ga0316582_0110899_744_1637 279
104 3300036712 Ga0316584_0047295 Ga0316584_0047295_1351_2244 279
105 3300036647 Ga0316582_0012057 Ga0316582_0012057_2076_2993 280
106 3300031344 Ga0265316_10327106 Ga0265316_103271061 281
107 3300039093 Ga0400489_71322 Ga0400489_71322_488_1408 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06966

DUF1295

Protein of unknown function (DUF1295)

104

319

0.96

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

184

294

0.75

PF02544

Steroid_dh

3-oxo-5-alpha-steroid 4-dehydrogenase

178

325

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.5587 22 270
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.5539 22 271
4quv-assembly3.cif.gz_B structure of an integral membrane delta(14)-sterol reductase 0.5489 12 270
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.5451 22 270
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.5406 22 271
ID Description Score Start End Superfamily
af_F1QW92_73_271_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9707 73 271 1.20.120.1630
af_F1QW92_73_271_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.966 73 271 1.20.120.1630
af_I1KQJ7_60_258_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9538 75 271 1.20.120.1630
af_I1KQJ7_60_258_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.94 75 271 1.20.120.1630
af_Q54W87_65_266_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9347 75 272 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A2E6UND9-F1-model_v4 Uncharacterized protein 0.9912 13 271 GO:0016020
AF-A0A2E4PTU1-F1-model_v4 Uncharacterized protein 0.9901 13 273 GO:0016020
AF-A0A420WK32-F1-model_v4 Steroid 5-alpha reductase family enzyme 0.9891 13 272 GO:0016020
AF-A0A7S2S2V5-F1-model_v4 Steroid 5-alpha reductase C-terminal domain-containing protein 0.9875 154 272 GO:0016020
AF-B7RTR0-F1-model_v4 Uncharacterized protein 0.9859 13 271 GO:0016020

Feature Viewer

pLDDT pTM Quality
90.03 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map