F038004

General Info

Members Datasets Scaffolds Average Seq Length
106 81 105 156

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10099330|Ga0182008_100993302
Length 168
Sequence MQPSDRSTASQPDEACVKDQYLITTRLIERLHRRFLDVIKTELDRLGIQDVNNVQTLILFNINEDQLTVGELTVRGYYLGSNVSYNVKKLVENGYLVQERSAHDRRQTRVRLSQKALDLTQRIDELYRRNAEELSGTLDDEQLKGVNGVLVSLERFWSSQIKYDPTFY

Samples

Sample ID Description Type Environment
1 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
26 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
27 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
30 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
31 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
33 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
39 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
40 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
41 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
49 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
50 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
51 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
52 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
53 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
54 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
55 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
58 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
59 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
60 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
69 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
70 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
71 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
72 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
73 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
74 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
75 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
76 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
77 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
78 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
79 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
80 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
81 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.11
Metatranscriptomes 0.94
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.98
Nodule 0
Rhizoplane 0.94
Rhizosphere 79.25
Stem 0
Stem Tuber 0
Unclassified 2.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000267 3300003187 Bacteria 59711
2 rootH2_10006294 3300003320 Bacteria 34676
3 rootL2_10188928 3300003322 Bacteria 3753
4 JGI25160J50197_1008282 3300003354 Bacteria 3973
5 Ga0055536_1007888 3300003781 Bacteria 4678
6 Ga0065165_1029660 3300005262 Bacteria 1750
7 Ga0070671_100944996 3300005355 Bacteria 754
8 Ga0070714_100001608 3300005435 Bacteria 16405
9 Ga0070710_10764740 3300005437 Bacteria 687
10 Ga0070679_101424079 3300005530 Bacteria 639
11 Ga0068853_100703173 3300005539 Bacteria 964
12 Ga0070704_100584186 3300005549 Bacteria 980
13 Ga0068857_100573655 3300005577 Bacteria 1064
14 Ga0068856_100353413 3300005614 Bacteria 1488
15 Ga0068863_100407107 3300005841 Bacteria 1331
16 Ga0081540_1185399 3300005983 Bacteria 773
17 Ga0081540_1327827 3300005983 Unclassified 525
18 Ga0070717_10008006 3300006028 Bacteria 7874
19 Ga0070717_10076129 3300006028 Bacteria 2808
20 Ga0070717_10137200 3300006028 Bacteria 2107
21 Ga0075430_100195590 3300006846 Bacteria 1680
22 Ga0099795_10419433 3300007788 Unclassified 611
23 Ga0105241_10313619 3300009174 Unclassified 1350
24 Ga0099796_10067476 3300010159 Unclassified 1283
25 Ga0157374_11543654 3300013296 Bacteria 688
26 Ga0182008_10099330 3300014497 Bacteria 1438
27 Ga0213872_10000278 3300021361 Bacteria 43638
28 Ga0213872_10062554 3300021361 Bacteria 1682
29 Ga0213872_10088914 3300021361 Bacteria 1383
30 Ga0209233_1031988 3300025261 Bacteria 1221
31 Ga0209130_1000469 3300025284 Bacteria 41793
32 Ga0209676_1000019 3300025292 Bacteria 620012
33 Ga0209025_1000467 3300025294 Bacteria 78947
34 Ga0209758_1003206 3300025297 Bacteria 15258
35 Ga0209050_1021109 3300025298 Bacteria 2389
36 Ga0207426_1000239 3300025302 Bacteria 123307
37 Ga0207700_10363328 3300025928 Bacteria 1263
38 Ga0207664_10001588 3300025929 Bacteria 14937
39 Ga0207712_10193346 3300025961 Unclassified 1607
40 Ga0207639_10831508 3300026041 Bacteria 861
41 Ga0207674_10205193 3300026116 Bacteria 1920
42 Ga0265338_10027388 3300028800 Bacteria 5718
43 Ga0265338_10716124 3300028800 Bacteria 690
44 Ga0265331_10007209 3300031250 Bacteria 6457
45 Ga0265331_10044633 3300031250 Bacteria 2142
46 Ga0265331_10073643 3300031250 Bacteria 1595
47 Ga0265314_10474530 3300031711 Bacteria 662
48 Ga0316576_10404013 3300031727 Bacteria 1012
49 Ga0307413_10888586 3300031824 Bacteria 756
50 Ga0307410_10294329 3300031852 Bacteria 1279
51 Ga0307416_100823204 3300032002 Unclassified 1025
52 Ga0307416_101057593 3300032002 Bacteria 916
53 Ga0307416_101151934 3300032002 Bacteria 881
54 Ga0316596_1149263 3300033541 Bacteria 642
55 Ga0395900_0208131 3300037418 Bacteria 1976
56 Ga0395898_0001457 3300037466 Bacteria 33463
57 Ga0395898_0671594 3300037466 Bacteria 978
58 Ga0436360_1052888 3300039438 Bacteria 876
59 Ga0436360_1230738 3300039438 Bacteria 3150
60 Ga0436361_0134884 3300039447 Bacteria 4888
61 Ga0436361_0670873 3300039447 Bacteria 567
62 Ga0436361_0778529 3300039447 Bacteria 39434
63 Ga0436361_0786735 3300039447 Bacteria 731
64 Ga0436362_0749705 3300039453 Bacteria 1229
65 Ga0439466_0143927 3300041411 Bacteria 731
66 Ga0439431_0066148 3300041997 Bacteria 957
67 Ga0439442_094069 3300042002 Bacteria 646
68 Ga0439460_0212408 3300042461 Bacteria 662
69 Ga0450918_131178 3300042531 Bacteria 507
70 Ga0466966_0359527 3300044684 Bacteria 875
71 Ga0495610_0276064 3300046512 Bacteria 656
72 Ga0495643_0222024 3300046522 Bacteria 896
73 Ga0496109_1362831 3300048912 Bacteria 645
74 Ga0501032_0000012 3300049569 Bacteria 193329
75 Ga0501032_0374279 3300049569 Bacteria 916
76 Ga0501034_0000001 3300049571 Bacteria 2184493
77 Ga0501034_0042734 3300049571 Bacteria 4588
78 Ga0501034_0177026 3300049571 Bacteria 2099
79 Ga0501034_0182974 3300049571 Bacteria 2060
80 Ga0501034_0411777 3300049571 Bacteria 1274
81 Ga0501034_0428006 3300049571 Bacteria 1244
82 Ga0501036_0011578 3300049572 Bacteria 7309
83 Ga0501036_0316893 3300049572 Bacteria 1303
84 Ga0501037_0608171 3300049573 Bacteria 733
85 Ga0501039_0000020 3300049575 Bacteria 162656
86 Ga0501039_0109537 3300049575 Bacteria 2159
87 Ga0501040_0424311 3300049576 Bacteria 956
88 Ga0501047_0086568 3300049581 Bacteria 3011
89 Ga0501048_0354387 3300049582 Bacteria 1047
90 Ga0501070_0068530 3300049586 Bacteria 2937
91 Ga0501070_0420075 3300049586 Bacteria 1080
92 Ga0501072_0062882 3300049588 Bacteria 2928
93 Ga0501072_0249405 3300049588 Bacteria 1414
94 Ga0501073_0498494 3300049589 Bacteria 842
95 Ga0501076_0488262 3300049592 Bacteria 1015
96 Ga0500555_072685 3300053103 Unclassified 905
97 Ga0500562_000021 3300053108 Bacteria 112425
98 Ga0500652_000221 3300053131 Bacteria 21886
99 Ga0500588_0023346 3300053146 Bacteria 1694
100 Ga0500633_0154277 3300053160 Bacteria 861
101 Ga0500637_0000317 3300053178 Bacteria 18056
102 Ga0500645_048892 3300053730 Bacteria 1238
103 Ga0501084_0142275 3300054114 Bacteria 2020
104 Ga0501082_0574633 3300060353 Bacteria 986
105 Ga0530510_0123231 3300061734 Bacteria 1904

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10205193 Ga0207674_102051932 136
2 3300025261 Ga0209233_1031988 Ga0209233_10319882 145
3 3300039447 Ga0436361_0670873 Ga0436361_0670873_111_554 147
4 3300053103 Ga0500555_072685 Ga0500555_072685_400_846 148
5 3300053108 Ga0500562_000021 Ga0500562_000021_83575_84021 148
6 3300039453 Ga0436362_0749705 Ga0436362_0749705_539_988 149
7 3300003322 rootL2_10188928 rootL2_101889283 150
8 3300005437 Ga0070710_10764740 Ga0070710_107647401 150
9 3300009174 Ga0105241_10313619 Ga0105241_103136192 150
10 3300028800 Ga0265338_10027388 Ga0265338_100273886 150
11 3300031250 Ga0265331_10007209 Ga0265331_100072099 150
12 3300031727 Ga0316576_10404013 Ga0316576_104040133 150
13 3300041411 Ga0439466_0143927 Ga0439466_0143927_153_605 150
14 3300042461 Ga0439460_0212408 Ga0439460_0212408_197_649 150
15 3300049572 Ga0501036_0316893 Ga0501036_0316893_520_972 150
16 3300049575 Ga0501039_0109537 Ga0501039_0109537_488_940 150
17 3300049576 Ga0501040_0424311 Ga0501040_0424311_35_487 150
18 3300049582 Ga0501048_0354387 Ga0501048_0354387_467_919 150
19 3300049588 Ga0501072_0062882 Ga0501072_0062882_1507_1959 150
20 3300049588 Ga0501072_0249405 Ga0501072_0249405_313_783 150
21 3300049592 Ga0501076_0488262 Ga0501076_0488262_147_599 150
22 3300053131 Ga0500652_000221 Ga0500652_000221_10751_11203 150
23 3300053160 Ga0500633_0154277 Ga0500633_0154277_263_715 150
24 3300054114 Ga0501084_0142275 Ga0501084_0142275_373_825 150
25 3300060353 Ga0501082_0574633 Ga0501082_0574633_416_868 150
26 3300061734 Ga0530510_0123231 Ga0530510_0123231_702_1154 150
27 3300005530 Ga0070679_101424079 Ga0070679_1014240792 151
28 3300021361 Ga0213872_10000278 Ga0213872_1000027811 151
29 3300031250 Ga0265331_10044633 Ga0265331_100446332 151
30 3300031250 Ga0265331_10073643 Ga0265331_100736432 151
31 3300031711 Ga0265314_10474530 Ga0265314_104745301 151
32 3300032002 Ga0307416_100823204 Ga0307416_1008232042 151
33 3300039447 Ga0436361_0778529 Ga0436361_0778529_35204_35659 151
34 3300039447 Ga0436361_0786735 Ga0436361_0786735_170_625 151
35 3300042531 Ga0450918_131178 Ga0450918_131178_40_495 151
36 3300049571 Ga0501034_0182974 Ga0501034_0182974_32_490 151
37 3300053178 Ga0500637_0000317 Ga0500637_0000317_11598_12053 151
38 3300005614 Ga0068856_100353413 Ga0068856_1003534132 152
39 3300014497 Ga0182008_10099330 Ga0182008_100993302 152
40 3300037466 Ga0395898_0001457 Ga0395898_0001457_19944_20402 152
41 3300037466 Ga0395898_0671594 Ga0395898_0671594_209_667 152
42 3300048912 Ga0496109_1362831 Ga0496109_1362831_15_521 152
43 3300049569 Ga0501032_0000012 Ga0501032_0000012_14876_15340 153
44 3300049571 Ga0501034_0000001 Ga0501034_0000001_1796524_1796988 153
45 3300049572 Ga0501036_0011578 Ga0501036_0011578_3315_3779 153
46 3300049575 Ga0501039_0000020 Ga0501039_0000020_58922_59386 153
47 3300053146 Ga0500588_0023346 Ga0500588_0023346_266_733 153
48 iso_pu_bacteria 2821443989 2821447752 154
49 3300005841 Ga0068863_100407107 Ga0068863_1004071071 155
50 3300013296 Ga0157374_11543654 Ga0157374_115436541 155
51 3300003781 Ga0055536_1007888 Ga0055536_10078882 157
52 3300005355 Ga0070671_100944996 Ga0070671_1009449961 157
53 3300005577 Ga0068857_100573655 Ga0068857_1005736552 157
54 3300006028 Ga0070717_10008006 Ga0070717_100080067 157
55 3300006028 Ga0070717_10076129 Ga0070717_100761292 157
56 3300006028 Ga0070717_10137200 Ga0070717_101372003 157
57 3300007788 Ga0099795_10419433 Ga0099795_104194331 157
58 3300010159 Ga0099796_10067476 Ga0099796_100674762 157
59 3300025292 Ga0209676_1000019 Ga0209676_100001980 157
60 3300025298 Ga0209050_1021109 Ga0209050_10211093 157
61 3300025928 Ga0207700_10363328 Ga0207700_103633282 157
62 3300031852 Ga0307410_10294329 Ga0307410_102943292 157
63 3300044684 Ga0466966_0359527 Ga0466966_0359527_288_761 157
64 3300049589 Ga0501073_0498494 Ga0501073_0498494_34_507 157
65 3300003187 JGI25151J46595_10000267 JGI25151J46595_100002679 158
66 3300003320 rootH2_10006294 rootH2_100062945 158
67 3300003354 JGI25160J50197_1008282 JGI25160J50197_10082823 158
68 3300005262 Ga0065165_1029660 Ga0065165_10296602 158
69 3300005435 Ga0070714_100001608 Ga0070714_10000160812 158
70 3300005539 Ga0068853_100703173 Ga0068853_1007031732 158
71 3300005549 Ga0070704_100584186 Ga0070704_1005841862 158
72 3300005983 Ga0081540_1185399 Ga0081540_11853992 158
73 3300005983 Ga0081540_1327827 Ga0081540_13278271 158
74 3300006846 Ga0075430_100195590 Ga0075430_1001955903 158
75 3300021361 Ga0213872_10062554 Ga0213872_100625542 158
76 3300021361 Ga0213872_10088914 Ga0213872_100889142 158
77 3300025284 Ga0209130_1000469 Ga0209130_10004698 158
78 3300025294 Ga0209025_1000467 Ga0209025_100046765 158
79 3300025297 Ga0209758_1003206 Ga0209758_10032065 158
80 3300025302 Ga0207426_1000239 Ga0207426_10002395 158
81 3300025929 Ga0207664_10001588 Ga0207664_100015883 158
82 3300025961 Ga0207712_10193346 Ga0207712_101933461 158
83 3300026041 Ga0207639_10831508 Ga0207639_108315082 158
84 3300028800 Ga0265338_10716124 Ga0265338_107161241 158
85 3300031824 Ga0307413_10888586 Ga0307413_108885861 158
86 3300032002 Ga0307416_101057593 Ga0307416_1010575932 158
87 3300032002 Ga0307416_101151934 Ga0307416_1011519342 158
88 3300033541 Ga0316596_1149263 Ga0316596_11492632 158
89 3300037418 Ga0395900_0208131 Ga0395900_0208131_446_931 158
90 3300039438 Ga0436360_1052888 Ga0436360_1052888_54_542 158
91 3300039438 Ga0436360_1230738 Ga0436360_1230738_1262_1738 158
92 3300039447 Ga0436361_0134884 Ga0436361_0134884_3622_4104 158
93 3300041997 Ga0439431_0066148 Ga0439431_0066148_282_758 158
94 3300042002 Ga0439442_094069 Ga0439442_094069_143_619 158
95 3300046512 Ga0495610_0276064 Ga0495610_0276064_103_579 158
96 3300046522 Ga0495643_0222024 Ga0495643_0222024_276_752 158
97 3300049569 Ga0501032_0374279 Ga0501032_0374279_94_579 158
98 3300049571 Ga0501034_0042734 Ga0501034_0042734_355_834 158
99 3300049571 Ga0501034_0177026 Ga0501034_0177026_714_1199 158
100 3300049571 Ga0501034_0411777 Ga0501034_0411777_157_633 158
101 3300049571 Ga0501034_0428006 Ga0501034_0428006_541_1020 158
102 3300049573 Ga0501037_0608171 Ga0501037_0608171_110_595 158
103 3300049581 Ga0501047_0086568 Ga0501047_0086568_158_643 158
104 3300049586 Ga0501070_0068530 Ga0501070_0068530_39_590 158
105 3300049586 Ga0501070_0420075 Ga0501070_0420075_185_670 158
106 3300053730 Ga0500645_048892 Ga0500645_048892_644_1120 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13463

HTH_27

Winged helix DNA-binding domain

51

116

0.97

PF12802

MarR_2

MarR family

49

107

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eri-assembly1.cif.gz_A-2 marr protein from peptoclostridium difficile da00132 0.842 8 145
3q5f-assembly1.cif.gz_B crystal structure of the salmonella transcriptional regulator slya in complex with dna 0.8386 8 144
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.8374 38 97
3deu-assembly1.cif.gz_A-2 crystal structure of transcription regulatory protein slya from salmonella typhimurium in complex with salicylate ligands 0.8368 1 144
4aih-assembly1.cif.gz_A crystal structure of rova from yersinia in its free form 0.8346 8 147
ID Description Score Start End Superfamily
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8498 38 96 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8486 36 96 1.10.10.10
5eriA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.842 8 145 1.10.10.10
4aikA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8412 8 144 1.10.10.10
3q5fB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8386 8 144 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2H6AZP1-F1-model_v4 Transcriptional regulator SlyA 0.9781 5 148 GO:0003700
GO:0006950
AF-A0A7V2TA75-F1-model_v4 MarR family transcriptional regulator 0.9746 1 148 GO:0003700
GO:0006950
AF-A0A2E0ENY9-F1-model_v4 MarR family transcriptional regulator 0.9719 7 147 GO:0003700
GO:0006950
AF-A0A537SVD1-F1-model_v4 Winged helix DNA-binding protein 0.9674 5 145 GO:0003677
GO:0003700
GO:0006950
AF-A0A2A5GCI5-F1-model_v4 MarR family transcriptional regulator 0.9667 5 148 GO:0003700
GO:0006950

Feature Viewer

pLDDT pTM Quality
87.16 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map