F037720

General Info

Members Datasets Scaffolds Average Seq Length
106 86 101 467

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10030577|Ga0105237_100305772
Length 496
Sequence VQSEGKRAEFSNPTYHLRLTTNEKNQYMSAKKWLTLSLLCLLSKAEAQQHNFSDKYVVPADTLVQQKLAHWQDVKFGLMMHCPEDEGWTVRRGPYSKSYNEYVQAYENLQTTFNPVKFNPEKWATAAKEAGMKYVVFTTKHHDGFCMFDTKETDYKITSSKTPFSANPKSNVAKEVFNAFRNEGMMVGAYFSKPDWHSPDYWWPYFPPKDRNVNYDPKKYPDRWNGFKQYTYNQIKELMTGYGNVDILWLDGGWVRPYSSIDTGVEWQRTIPYDQDIDMAKIAGMARENQPGLLVVDRTVSGEFENYVTPEQTVPKEPMLHPWESCITMGNSWSYVPGDHYKSTNDLIHLLVKIVSRGGNFLLNVGPSPEGDWSDTAYSRLKEIGQWMKVHGEAIYNTVPLAPYEKDNIVYLQSKDKKHLYLYLLSGEKDDVAVALPKEIVLNKFFLHKETKITLLDAPGENIKWQSKNDVTTIRIPGKLQNKTAGKYAVVFRIDL

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
4 2914759650 Rhizosphaericola mali Isolate Rhizosphere
5 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
66 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
67 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
77 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
78 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
79 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
80 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
85 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
86 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.28
Metatranscriptomes 0
Isolates 4.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.6
Nodule 0
Rhizoplane 0
Rhizosphere 84.91
Stem 0
Stem Tuber 0
Unclassified 8.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001816 3300003203 Bacteria 10018
2 rootL2_10315966 3300003322 Bacteria 1577
3 JGI25160J50197_1001504 3300003354 Bacteria 11581
4 Ga0065165_1000060 3300005262 Bacteria 180226
5 Ga0065712_10092102 3300005290 Bacteria 2344
6 Ga0070658_10090507 3300005327 Bacteria 2521
7 Ga0070683_100021099 3300005329 Bacteria 5809
8 Ga0070683_100130830 3300005329 Bacteria 2375
9 Ga0070690_100036340 3300005330 Bacteria 3095
10 Ga0068869_100087838 3300005334 Bacteria 2333
11 Ga0070660_100069987 3300005339 Bacteria 2737
12 Ga0070659_100000154 3300005366 Bacteria 52564
13 Ga0070659_100006059 3300005366 Bacteria 8722
14 Ga0070698_100028376 3300005471 Bacteria 5814
15 Ga0070679_100007550 3300005530 Bacteria 10169
16 Ga0070684_100193129 3300005535 Bacteria 1853
17 Ga0070684_100220305 3300005535 Bacteria 1731
18 Ga0068853_100240116 3300005539 Bacteria 1660
19 Ga0068855_100014228 3300005563 Bacteria 9584
20 Ga0070664_100010561 3300005564 Bacteria 7486
21 Ga0070664_100060557 3300005564 Bacteria 3224
22 Ga0068852_100006788 3300005616 Bacteria 8306
23 Ga0068852_100135223 3300005616 Bacteria 2276
24 Ga0068859_100000727 3300005617 Bacteria 33122
25 Ga0068863_100001482 3300005841 Bacteria 23269
26 Ga0068862_100057867 3300005844 Bacteria 3326
27 Ga0097620_100000727 3300006931 Bacteria 33122
28 Ga0105245_10111700 3300009098 Bacteria 2542
29 Ga0105241_10145425 3300009174 Bacteria 1934
30 Ga0105242_10018066 3300009176 Bacteria 5507
31 Ga0105248_10113547 3300009177 Bacteria 3055
32 Ga0105237_10030577 3300009545 Bacteria 5468
33 Ga0105239_10016287 3300010375 Bacteria 8221
34 Ga0157373_10005846 3300013100 Bacteria 9208
35 Ga0157373_10021147 3300013100 Bacteria 4723
36 Ga0157371_10002641 3300013102 Bacteria 17010
37 Ga0157371_10019281 3300013102 Bacteria 5032
38 Ga0157370_10067466 3300013104 Bacteria 3381
39 Ga0157374_10005241 3300013296 Bacteria 10874
40 Ga0157374_10011049 3300013296 Bacteria 7799
41 Ga0157378_10032642 3300013297 Bacteria 4601
42 Ga0163162_10007212 3300013306 Bacteria 10793
43 Ga0163162_10030386 3300013306 Bacteria 5354
44 Ga0163162_10253036 3300013306 Bacteria 1893
45 Ga0157372_10099109 3300013307 Bacteria 3324
46 Ga0157375_10242604 3300013308 Bacteria 1962
47 Ga0163163_10154505 3300014325 Bacteria 2339
48 Ga0157380_10068679 3300014326 Bacteria 2857
49 Ga0157376_10102258 3300014969 Bacteria 2506
50 Ga0182007_10002486 3300015262 Bacteria 9123
51 Ga0209676_1000342 3300025292 Bacteria 88613
52 Ga0207426_1000009 3300025302 Bacteria 797229
53 Ga0207657_10012490 3300025919 Bacteria 8381
54 Ga0207657_10023097 3300025919 Bacteria 5800
55 Ga0207657_10087095 3300025919 Bacteria 2613
56 Ga0207652_10002737 3300025921 Bacteria 14797
57 Ga0207706_10007957 3300025933 Bacteria 9787
58 Ga0207661_10015639 3300025944 Bacteria 5589
59 Ga0207661_10120950 3300025944 Bacteria 2229
60 Ga0207667_10088282 3300025949 Unclassified 3207
61 Ga0207641_10000275 3300026088 Bacteria 64649
62 Ga0207641_10034070 3300026088 Bacteria 4234
63 Ga0207676_10096191 3300026095 Bacteria 2444
64 Ga0268264_10039796 3300028381 Bacteria 3884
65 Ga0307517_10005695 3300028786 Bacteria 18663
66 Ga0307515_10000001 3300028794 Bacteria 4259510
67 Ga0265327_10000192 3300031251 Bacteria 129439
68 Ga0265327_10000432 3300031251 Bacteria 75935
69 Ga0265327_10028335 3300031251 Bacteria 3206
70 Ga0307509_10059054 3300031507 Bacteria 4059
71 Ga0307509_10082656 3300031507 Bacteria 3313
72 Ga0307508_10000603 3300031616 Bacteria 43051
73 Ga0316578_10000519 3300031728 Bacteria 13106
74 Ga0316578_10004279 3300031728 Bacteria 6707
75 Ga0307405_10011417 3300031731 Bacteria 4654
76 Ga0307412_10110156 3300031911 Bacteria 1964
77 Ga0307414_10002464 3300032004 Bacteria 9701
78 Ga0307414_10045849 3300032004 Bacteria 2996
79 Ga0316583_10004813 3300032133 Bacteria 4820
80 Ga0316580_10018300 3300032139 Bacteria 2155
81 Ga0307507_10127212 3300033179 Bacteria 2010
82 Ga0395905_0095738 3300037471 Bacteria 2787
83 Ga0450922_002453 3300042124 Bacteria 1746
84 Ga0451577_0209252 3300042876 Bacteria 1762
85 Ga0466972_0000112 3300044658 Bacteria 70349
86 Ga0453684_0138166 3300044712 Bacteria 2914
87 Ga0453684_0178984 3300044712 Bacteria 2491
88 Ga0466970_0000219 3300044765 Bacteria 28141
89 Ga0451576_0109905 3300045051 Bacteria 2869
90 Ga0466967_0134819 3300045976 Bacteria 2296
91 Ga0495594_0005832 3300046499 Bacteria 6326
92 Ga0495625_0048929 3300046660 Bacteria 3041
93 Ga0495672_0013288 3300047320 Bacteria 5688
94 Ga0495684_0031607 3300047471 Bacteria 4065
95 Ga0501036_0087983 3300049572 Bacteria 2625
96 Ga0501037_0103242 3300049573 Bacteria 2056
97 Ga0501038_0069037 3300049574 Bacteria 3003
98 Ga0501080_0069738 3300049742 Bacteria 3270
99 Ga0500562_000030 3300053108 Bacteria 92407
100 Ga0500588_0001531 3300053146 Bacteria 4435
101 Ga0500622_0000560 3300053156 Bacteria 34086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005290 Ga0065712_10092102 Ga0065712_100921022 407
2 3300049573 Ga0501037_0103242 Ga0501037_0103242_19_1278 417
3 3300032004 Ga0307414_10002464 Ga0307414_100024647 437
4 3300005334 Ga0068869_100087838 Ga0068869_1000878382 439
5 iso_pu_bacteria 2522125168 2522548358 440
6 3300005330 Ga0070690_100036340 Ga0070690_1000363402 441
7 3300005471 Ga0070698_100028376 Ga0070698_1000283764 441
8 3300014326 Ga0157380_10068679 Ga0157380_100686793 443
9 3300013102 Ga0157371_10019281 Ga0157371_100192811 444
10 3300005841 Ga0068863_100001482 Ga0068863_10000148216 445
11 3300014325 Ga0163163_10154505 Ga0163163_101545052 445
12 3300026088 Ga0207641_10000275 Ga0207641_1000027541 445
13 3300053108 Ga0500562_000030 Ga0500562_000030_62104_63546 445
14 3300005844 Ga0068862_100057867 Ga0068862_1000578672 447
15 3300013100 Ga0157373_10021147 Ga0157373_100211472 447
16 3300005262 Ga0065165_1000060 Ga0065165_10000608 448
17 3300013104 Ga0157370_10067466 Ga0157370_100674663 448
18 3300025292 Ga0209676_1000342 Ga0209676_100034242 448
19 3300031731 Ga0307405_10011417 Ga0307405_100114173 448
20 3300031911 Ga0307412_10110156 Ga0307412_101101561 448
21 3300044712 Ga0453684_0138166 Ga0453684_0138166_818_2263 448
22 3300042124 Ga0450922_002453 Ga0450922_002453_162_1625 449
23 iso_pu_bacteria 2911138879 2911140031 449
24 3300037471 Ga0395905_0095738 Ga0395905_0095738_392_1837 450
25 3300013307 Ga0157372_10099109 Ga0157372_100991093 451
26 3300042876 Ga0451577_0209252 Ga0451577_0209252_57_1481 451
27 3300045051 Ga0451576_0109905 Ga0451576_0109905_1349_2773 451
28 3300009098 Ga0105245_10111700 Ga0105245_101117002 452
29 3300009176 Ga0105242_10018066 Ga0105242_100180663 452
30 3300009177 Ga0105248_10113547 Ga0105248_101135471 452
31 3300013306 Ga0163162_10007212 Ga0163162_100072124 452
32 3300028794 Ga0307515_10000001 Ga0307515_100000011007 452
33 3300031728 Ga0316578_10004279 Ga0316578_100042794 452
34 3300032133 Ga0316583_10004813 Ga0316583_100048134 452
35 3300046499 Ga0495594_0005832 Ga0495594_0005832_1467_2927 452
36 3300047471 Ga0495684_0031607 Ga0495684_0031607_1876_3333 452
37 3300005366 Ga0070659_100000154 Ga0070659_10000015425 453
38 3300047320 Ga0495672_0013288 Ga0495672_0013288_1665_3083 453
39 iso_pu_bacteria 2914759650 2914762392 453
40 iso_pu_bacteria 2929154850 2929158078 453
41 3300005617 Ga0068859_100000727 Ga0068859_10000072717 454
42 3300006931 Ga0097620_100000727 Ga0097620_10000072717 454
43 3300025919 Ga0207657_10023097 Ga0207657_100230973 454
44 3300026088 Ga0207641_10034070 Ga0207641_100340702 454
45 3300031251 Ga0265327_10000192 Ga0265327_10000192127 454
46 3300031728 Ga0316578_10000519 Ga0316578_100005196 454
47 3300032139 Ga0316580_10018300 Ga0316580_100183002 454
48 iso_pu_bacteria 2818991444 2819587891 454
49 3300013306 Ga0163162_10030386 Ga0163162_100303867 455
50 3300031251 Ga0265327_10028335 Ga0265327_100283352 455
51 3300031507 Ga0307509_10059054 Ga0307509_100590544 455
52 3300053156 Ga0500622_0000560 Ga0500622_0000560_6071_7513 455
53 3300005329 Ga0070683_100021099 Ga0070683_1000210992 456
54 3300031251 Ga0265327_10000432 Ga0265327_1000043249 456
55 3300033179 Ga0307507_10127212 Ga0307507_101272122 456
56 3300044658 Ga0466972_0000112 Ga0466972_0000112_61579_63021 456
57 3300044765 Ga0466970_0000219 Ga0466970_0000219_7171_8613 456
58 3300015262 Ga0182007_10002486 Ga0182007_100024863 457
59 3300032004 Ga0307414_10045849 Ga0307414_100458492 457
60 3300044712 Ga0453684_0178984 Ga0453684_0178984_557_1999 457
61 3300009174 Ga0105241_10145425 Ga0105241_101454252 459
62 3300013296 Ga0157374_10005241 Ga0157374_100052419 459
63 3300005329 Ga0070683_100130830 Ga0070683_1001308302 460
64 3300005530 Ga0070679_100007550 Ga0070679_1000075508 460
65 3300005616 Ga0068852_100006788 Ga0068852_1000067885 460
66 3300025919 Ga0207657_10087095 Ga0207657_100870952 460
67 3300025921 Ga0207652_10002737 Ga0207652_100027377 460
68 3300028381 Ga0268264_10039796 Ga0268264_100397962 460
69 3300028786 Ga0307517_10005695 Ga0307517_100056954 460
70 3300031616 Ga0307508_10000603 Ga0307508_100006036 460
71 3300003203 JGI25406J46586_10001816 JGI25406J46586_100018162 461
72 3300003322 rootL2_10315966 rootL2_103159661 461
73 3300003354 JGI25160J50197_1001504 JGI25160J50197_10015049 461
74 3300005327 Ga0070658_10090507 Ga0070658_100905071 461
75 3300005339 Ga0070660_100069987 Ga0070660_1000699873 461
76 3300005366 Ga0070659_100006059 Ga0070659_1000060595 461
77 3300005535 Ga0070684_100193129 Ga0070684_1001931292 461
78 3300005535 Ga0070684_100220305 Ga0070684_1002203051 461
79 3300005539 Ga0068853_100240116 Ga0068853_1002401161 461
80 3300005563 Ga0068855_100014228 Ga0068855_1000142282 461
81 3300005564 Ga0070664_100010561 Ga0070664_1000105615 461
82 3300005564 Ga0070664_100060557 Ga0070664_1000605571 461
83 3300005616 Ga0068852_100135223 Ga0068852_1001352232 461
84 3300009545 Ga0105237_10030577 Ga0105237_100305772 461
85 3300010375 Ga0105239_10016287 Ga0105239_100162876 461
86 3300013100 Ga0157373_10005846 Ga0157373_100058466 461
87 3300013102 Ga0157371_10002641 Ga0157371_1000264113 461
88 3300013296 Ga0157374_10011049 Ga0157374_100110496 461
89 3300013297 Ga0157378_10032642 Ga0157378_100326422 461
90 3300013306 Ga0163162_10253036 Ga0163162_102530362 461
91 3300013308 Ga0157375_10242604 Ga0157375_102426041 461
92 3300014969 Ga0157376_10102258 Ga0157376_101022582 461
93 3300025302 Ga0207426_1000009 Ga0207426_1000009197 461
94 3300025919 Ga0207657_10012490 Ga0207657_100124906 461
95 3300025933 Ga0207706_10007957 Ga0207706_100079571 461
96 3300025944 Ga0207661_10015639 Ga0207661_100156393 461
97 3300025944 Ga0207661_10120950 Ga0207661_101209502 461
98 3300025949 Ga0207667_10088282 Ga0207667_100882822 461
99 3300026095 Ga0207676_10096191 Ga0207676_100961912 461
100 3300031507 Ga0307509_10082656 Ga0307509_100826563 461
101 3300045976 Ga0466967_0134819 Ga0466967_0134819_391_1833 461
102 3300046660 Ga0495625_0048929 Ga0495625_0048929_255_1712 461
103 3300049572 Ga0501036_0087983 Ga0501036_0087983_138_1580 461
104 3300049574 Ga0501038_0069037 Ga0501038_0069037_252_1694 461
105 3300049742 Ga0501080_0069738 Ga0501080_0069738_1433_2875 461
106 3300053146 Ga0500588_0001531 Ga0500588_0001531_2220_3758 461

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01120

Alpha_L_fucos

Alpha-L-fucosidase

43

393

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gn6-assembly1.cif.gz_E alpha-l-fucosidase isoenzyme 1 from paenibacillus thiaminolyticus 0.7788 33 459
6gn6-assembly1.cif.gz_E alpha-l-fucosidase isoenzyme 1 from paenibacillus thiaminolyticus 0.7721 33 459
7db5-assembly1.cif.gz_A crystal structure of alpha-l-fucosidase from vibrio sp. strain ejy3 0.7692 35 460
6o1j-assembly3.cif.gz_F alpha-l-fucosidase alfc fucosyltransferase mutant n243a 0.7654 36 360
6o1i-assembly2.cif.gz_D-2 alpha-l-fucosidase alfc fucosyltransferase mutant e274a 0.7649 36 354
ID Description Score Start End Superfamily
6gn6F01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8033 36 363 3.20.20.80
6gn6F01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.801 36 363 3.20.20.80
af_Q99LJ1_352_452_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7632 360 460 2.60.40.1180
af_Q7XUR3_35_350_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7571 27 359 3.20.20.80
af_Q551C1_359_456_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7487 362 461 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A4V1UPS3-F1-model_v4 Alpha-L-fucosidase 0.9518 185 461 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A7V4M0M0-F1-model_v4 Alpha-L-fucosidase 0.9502 94 461 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A4V1UPS3-F1-model_v4 Alpha-L-fucosidase 0.9451 185 461 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A519VNQ2-F1-model_v4 Alpha-L-fucosidase 0.945 138 460 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A3N5SN31-F1-model_v4 deleted 0.9439 245 460

Feature Viewer

pLDDT pTM Quality
88 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map