F028519

General Info

Members Datasets Scaffolds Average Seq Length
104 85 208 62

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0022723|Ga0496103_0022723_3483_3704
Length 73
Sequence MNARYRTGTVVFNAQTGFPPGKVRFVHTLNGSGLAVGRTLVAVIENYQQEDGSVAIPDALRSYMGGLEKIAAA

Samples

Sample ID Description Type Environment
1 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
2 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
3 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
4 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
5 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
6 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
7 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
8 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
9 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
10 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
11 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
12 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
13 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
14 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
15 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
16 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
17 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
18 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
19 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
20 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
21 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
22 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
23 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
24 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
25 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
26 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
27 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
28 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
29 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
30 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
31 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
32 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
33 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
34 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
35 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
36 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
37 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
38 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
39 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
40 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
41 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
42 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
43 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
44 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
45 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
46 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
47 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
48 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
49 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
50 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
51 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
52 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
53 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
54 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
55 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
56 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
57 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
58 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
59 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
60 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
61 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
62 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
63 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
64 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
65 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
66 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
67 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
75 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
76 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
77 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
78 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
79 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
80 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
81 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
82 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
83 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
84 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
85 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 12.5
Rhizosphere 74.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496103_0022723 3300048906 Bacteria 3778
2 Ga0105244_10235932 3300009036 Bacteria 855
3 Ga0182005_1001806 3300015265 Bacteria 8179
4 Ga0207653_10229902 3300025885 Bacteria 706
5 Ga0207707_10664595 3300025912 Bacteria 877
6 Ga0207640_10562117 3300025981 Bacteria 960
7 Ga0373938_0243546 3300034957 Bacteria 512
8 Ga0373940_0201720 3300035088 Bacteria 654
9 Ga0373939_0475673 3300035114 Bacteria 530
10 Ga0373954_0528835 3300035118 Bacteria 584
11 Ga0316574_0372853 3300035398 Bacteria 901
12 Ga0373937_1340801 3300036401 Bacteria 663
13 Ga0395899_0108949 3300037312 Bacteria 1993
14 Ga0395900_0710113 3300037418 Bacteria 938
15 Ga0395900_1549738 3300037418 Bacteria 574
16 Ga0395900_1796325 3300037418 Bacteria 524
17 Ga0395898_0411085 3300037466 Bacteria 1290
18 Ga0395905_0064895 3300037471 Bacteria 3418
19 Ga0436364_0546389 3300037853 Bacteria 1123
20 Ga0400483_143746 3300039062 Bacteria 1260
21 Ga0400483_215034 3300039062 Bacteria 1166
22 Ga0436363_0623528 3300039450 Bacteria 683
23 Ga0436363_1337996 3300039450 Bacteria 698
24 Ga0451802_0201729 3300041460 Bacteria 631
25 Ga0451807_0653194 3300041486 Bacteria 955
26 Ga0451843_1403231 3300041509 Bacteria 1534
27 Ga0439432_007236 3300042006 Bacteria 3942
28 Ga0450900_004154 3300042136 Bacteria 1651
29 Ga0450900_007156 3300042136 Bacteria 1369
30 Ga0450902_000021 3300042137 Bacteria 14340
31 Ga0439459_0053528 3300042438 Bacteria 893
32 Ga0451577_0640866 3300042876 Bacteria 964
33 Ga0466969_0422564 3300044656 Bacteria 605
34 Ga0466978_0214385 3300044671 Bacteria 1139
35 Ga0466961_0000485 3300044693 Bacteria 25284
36 Ga0466964_0313670 3300044706 Bacteria 794
37 Ga0453684_1258349 3300044712 Bacteria 774
38 Ga0453684_1788812 3300044712 Bacteria 625
39 Ga0466970_0053698 3300044765 Bacteria 2152
40 Ga0466959_0000891 3300045049 Bacteria 17569
41 Ga0451576_0062399 3300045051 Bacteria 3885
42 Ga0451576_0081853 3300045051 Bacteria 3357
43 Ga0495603_0174987 3300046455 Bacteria 1242
44 Ga0495650_0246954 3300046471 Bacteria 608
45 Ga0495585_0401144 3300046492 Bacteria 660
46 Ga0495583_0456539 3300046506 Bacteria 500
47 Ga0495606_0065757 3300046507 Bacteria 2302
48 Ga0495616_0000962 3300046513 Bacteria 20663
49 Ga0495616_0005081 3300046513 Bacteria 8181
50 Ga0495632_0313809 3300046519 Bacteria 693
51 Ga0495652_1032469 3300046529 Bacteria 536
52 Ga0495609_0000229 3300046538 Bacteria 53704
53 Ga0495645_0562195 3300046543 Bacteria 706
54 Ga0495622_0452435 3300046557 Bacteria 551
55 Ga0495625_0024099 3300046660 Bacteria 4638
56 Ga0495625_0335544 3300046660 Bacteria 959
57 Ga0495588_0477058 3300046674 Bacteria 654
58 Ga0495588_0725515 3300046674 Bacteria 520
59 Ga0495599_0444658 3300046678 Bacteria 768
60 Ga0495647_0153204 3300046681 Bacteria 989
61 Ga0495613_1067274 3300046689 Bacteria 517
62 Ga0495589_0003274 3300046794 Bacteria 8806
63 Ga0495604_0240175 3300047317 Bacteria 1239
64 Ga0495672_0395065 3300047320 Bacteria 633
65 Ga0495673_0357482 3300047469 Bacteria 514
66 Ga0495614_0290519 3300048089 Bacteria 754
67 Ga0496101_0306466 3300048904 Bacteria 1245
68 Ga0496101_0851320 3300048904 Bacteria 718
69 Ga0496102_0920088 3300048905 Bacteria 796
70 Ga0496102_1250079 3300048905 Bacteria 662
71 Ga0496103_0941623 3300048906 Bacteria 540
72 Ga0496104_0653993 3300048907 Bacteria 960
73 Ga0496109_0674133 3300048912 Bacteria 971
74 Ga0496110_0670913 3300048913 Bacteria 937
75 Ga0496111_0427180 3300048914 Bacteria 979
76 Ga0496111_0757496 3300048914 Bacteria 704
77 Ga0496124_0106971 3300048927 Bacteria 2258
78 Ga0496124_0199888 3300048927 Bacteria 1521
79 Ga0496124_0220648 3300048927 Bacteria 1426
80 Ga0496124_0500561 3300048927 Bacteria 815
81 Ga0496125_0492841 3300048928 Bacteria 691
82 Ga0496126_0123860 3300048929 Bacteria 2239
83 Ga0495678_222173 3300049459 Bacteria 572
84 Ga0501031_0538274 3300049568 Bacteria 752
85 Ga0501033_0057541 3300049570 Bacteria 2873
86 Ga0501034_0875775 3300049571 Bacteria 787
87 Ga0501042_0541127 3300049578 Bacteria 846
88 Ga0501048_0041308 3300049582 Bacteria 3304
89 Ga0501067_0194668 3300049583 Bacteria 1129
90 Ga0501071_1322302 3300049587 Bacteria 557
91 Ga0501071_1413313 3300049587 Bacteria 537
92 Ga0501239_075602 3300049672 Bacteria 531
93 Ga0501080_1819228 3300049742 Bacteria 511
94 Ga0501081_0832200 3300049743 Bacteria 695
95 Ga0501083_0005630 3300049744 Bacteria 8869
96 Ga0501035_0680514 3300049822 Bacteria 831
97 Ga0501035_1426613 3300049822 Bacteria 530
98 nmdc:mga05p37_2005742_c1 3300050507 Bacteria 547
99 nmdc:mga0n895_1873469_c1 3300050512 Bacteria 559
100 nmdc:mga0rr50_332932_c1 3300050513 Bacteria 1275
101 Ga0495601_0387643 3300053077 Bacteria 906
102 Ga0500643_196054 3300053087 Bacteria 542
103 Ga0466962_0543700 3300061719 Bacteria 590
104 Ga0530510_0538813 3300061734 Bacteria 886
105 Ga0496103_0022723
106 Ga0105244_10235932
107 Ga0182005_1001806
108 Ga0207653_10229902
109 Ga0207707_10664595
110 Ga0207640_10562117
111 Ga0373938_0243546
112 Ga0373940_0201720
113 Ga0373939_0475673
114 Ga0373954_0528835
115 Ga0316574_0372853
116 Ga0373937_1340801
117 Ga0395899_0108949
118 Ga0395900_0710113
119 Ga0395900_1549738
120 Ga0395900_1796325
121 Ga0395898_0411085
122 Ga0395905_0064895
123 Ga0436364_0546389
124 Ga0400483_143746
125 Ga0400483_215034
126 Ga0436363_0623528
127 Ga0436363_1337996
128 Ga0451802_0201729
129 Ga0451807_0653194
130 Ga0451843_1403231
131 Ga0439432_007236
132 Ga0450900_004154
133 Ga0450900_007156
134 Ga0450902_000021
135 Ga0439459_0053528
136 Ga0451577_0640866
137 Ga0466969_0422564
138 Ga0466978_0214385
139 Ga0466961_0000485
140 Ga0466964_0313670
141 Ga0453684_1258349
142 Ga0453684_1788812
143 Ga0466970_0053698
144 Ga0466959_0000891
145 Ga0451576_0062399
146 Ga0451576_0081853
147 Ga0495603_0174987
148 Ga0495650_0246954
149 Ga0495585_0401144
150 Ga0495583_0456539
151 Ga0495606_0065757
152 Ga0495616_0000962
153 Ga0495616_0005081
154 Ga0495632_0313809
155 Ga0495652_1032469
156 Ga0495609_0000229
157 Ga0495645_0562195
158 Ga0495622_0452435
159 Ga0495625_0024099
160 Ga0495625_0335544
161 Ga0495588_0477058
162 Ga0495588_0725515
163 Ga0495599_0444658
164 Ga0495647_0153204
165 Ga0495613_1067274
166 Ga0495589_0003274
167 Ga0495604_0240175
168 Ga0495672_0395065
169 Ga0495673_0357482
170 Ga0495614_0290519
171 Ga0496101_0306466
172 Ga0496101_0851320
173 Ga0496102_0920088
174 Ga0496102_1250079
175 Ga0496103_0941623
176 Ga0496104_0653993
177 Ga0496109_0674133
178 Ga0496110_0670913
179 Ga0496111_0427180
180 Ga0496111_0757496
181 Ga0496124_0106971
182 Ga0496124_0199888
183 Ga0496124_0220648
184 Ga0496124_0500561
185 Ga0496125_0492841
186 Ga0496126_0123860
187 Ga0495678_222173
188 Ga0501031_0538274
189 Ga0501033_0057541
190 Ga0501034_0875775
191 Ga0501042_0541127
192 Ga0501048_0041308
193 Ga0501067_0194668
194 Ga0501071_1322302
195 Ga0501071_1413313
196 Ga0501239_075602
197 Ga0501080_1819228
198 Ga0501081_0832200
199 Ga0501083_0005630
200 Ga0501035_0680514
201 Ga0501035_1426613
202 nmdc:mga05p37_2005742_c1
203 nmdc:mga0n895_1873469_c1
204 nmdc:mga0rr50_332932_c1
205 Ga0495601_0387643
206 Ga0500643_196054
207 Ga0466962_0543700
208 Ga0530510_0538813

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6x94-assembly1.cif.gz_A an orthogonal seryl-trna synthetase/trna pair for noncanonical amino acid mutagenesis in escherichia coli 0.6474 4 59
6h9x-assembly1.cif.gz_A klebsiella pneumoniae seryl-trna synthetase in complex with the intermediate analog 5'-o-(n-(l-seryl)-sulfamoyl)adenosine 0.6139 1 60
7ap1-assembly1.cif.gz_A-2 klebsiella pneumoniae seryl-trna synthetase in complex with compound sers7hmdda 0.6134 1 60
6hhy-assembly1.cif.gz_A-2 klebsiella pneumoniae seryl-trna synthetase in complex with 5'-o-(n-(l-seryl)-sulfamoyl)n3-methyluridine 0.6133 1 60
6r1o-assembly1.cif.gz_A-2 crystal structure of e. coli seryl-trna synthetase complexed to a seryl sulfamoyl adenosine derivative 0.6105 1 61
ID Description Score Start End Superfamily
af_I1JVB5_172_505_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9487 25 63 3.30.930.10
af_K7KUA0_1_159_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.897 24 63 3.30.930.10
af_Q4CW46_1_226_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8083 27 65 3.30.930.10
af_A0A1D6EB49_6_63_1.10.245.10 Mainly Alpha;Orthogonal Bundle;MDM2;SWIB/MDM2 domain 0.6774 27 59 1.10.245.10
af_A0A0R0FLV6_175_254_1.10.245.10 Mainly Alpha;Orthogonal Bundle;MDM2;SWIB/MDM2 domain 0.6464 22 60 1.10.245.10
ID Description Score Start End GO Terms
AF-A0A7S2TL55-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) 0.9579 27 60 GO:0004828
GO:0005524
GO:0006434
AF-K2F3B3-F1-model_v4 Serine--tRNA ligase 0.9547 35 61
AF-A0A380ZN15-F1-model_v4 Serine--tRNA ligase (EC 6.1.1.11) 0.9541 25 61 GO:0004828
GO:0005524
GO:0005737
GO:0006434
AF-A0A497NQ41-F1-model_v4 Serine--tRNA ligase (EC 6.1.1.11) 0.9465 25 62 GO:0004828
GO:0005524
GO:0005737
GO:0006434
AF-A0A225UHJ5-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) 0.9402 24 62 GO:0004828
GO:0005524
GO:0006434

Map