F027175

General Info

Members Datasets Scaffolds Average Seq Length
104 64 208 342

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10001161|Ga0265338_1000116112
Length 381
Sequence LKILILKPSSLGDVIQALPVLRLIKSHLPASEVFWWIDAHLAPLLEGDPDLAGVVRFERKRWAAPRHWPEMLHSIHWMREQHFDWVIDLQCLARSGAFAWLASGKLLIGLDEVREGARGFYDVAVRRASFHTHAADWYLAVLPKLGVPVHKNFQWLPERPAVAAEVKRKWPGEAQKGKDEGREPVRTPILRSEAAEGRPDSHPSLRSYGGQAALRTAHWIALQPGARWENKRWPAGHYAELIRRMAGKFPDARFAILGAAEDRPLGEIIARAQPQRCLNLCGQTSLPEMVEWLRRCDLLVTNDTGPMHAAAALGRPLVAIFGPTEPRRTGPYGHLESVLRIDLPCSPCLKSHCTYEKPDECLKAISPETVFERACRLLTPA

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
11 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
12 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
13 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
20 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
21 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
22 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
23 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
24 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
25 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
26 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
27 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
28 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
29 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
30 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
31 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
32 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
33 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
34 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
35 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
36 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
37 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
38 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
39 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
40 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
41 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
42 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
43 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
44 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
45 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
46 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
47 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
48 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
49 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
50 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
53 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
54 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
55 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
56 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
57 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
58 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
59 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
63 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.08
Stem 0
Stem Tuber 0
Unclassified 16.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10001161 3300028800 Bacteria 43536
2 rootH2_10022110 3300003320 Bacteria 27136
3 rootH1_10340113 3300003323 Unclassified 2422
4 Ga0070690_100001616 3300005330 Bacteria 11840
5 Ga0070689_100158400 3300005340 Bacteria 1829
6 Ga0070711_100003213 3300005439 Bacteria 9489
7 Ga0068855_100033010 3300005563 Bacteria 6180
8 Ga0068855_100114390 3300005563 Bacteria 3094
9 Ga0068856_100000102 3300005614 Bacteria 82381
10 Ga0068856_100019316 3300005614 Bacteria 6615
11 Ga0081455_10033330 3300005937 Unclassified 4629
12 Ga0105240_10015748 3300009093 Bacteria 10261
13 Ga0105240_10556378 3300009093 Bacteria 1268
14 Ga0105238_10036573 3300009551 Bacteria 4992
15 Ga0105238_10040550 3300009551 Unclassified 4717
16 Ga0163163_10478391 3300014325 Bacteria 1306
17 Ga0207663_10039045 3300025916 Bacteria 2874
18 Ga0207694_10015291 3300025924 Bacteria 5791
19 Ga0207694_10019414 3300025924 Bacteria 5137
20 Ga0207694_10033544 3300025924 Unclassified 3933
21 Ga0207670_10025505 3300025936 Bacteria 3712
22 Ga0207667_10052657 3300025949 Bacteria 4285
23 Ga0207667_10135739 3300025949 Bacteria 2533
24 Ga0207702_10011578 3300026078 Bacteria 7350
25 Ga0207702_10016302 3300026078 Bacteria 6150
26 Ga0207641_10089042 3300026088 Bacteria 2697
27 Ga0265337_1000023 3300028556 Bacteria 72895
28 Ga0265337_1001066 3300028556 Bacteria 14147
29 Ga0265337_1001693 3300028556 Bacteria 10702
30 Ga0265337_1002135 3300028556 Bacteria 9317
31 Ga0265337_1008111 3300028556 Bacteria 3855
32 Ga0265326_10011080 3300028558 Bacteria 2665
33 Ga0265319_1000027 3300028563 Bacteria 139786
34 Ga0265319_1026843 3300028563 Unclassified 2047
35 Ga0265318_10008233 3300028577 Bacteria 4657
36 Ga0265323_10000043 3300028653 Bacteria 69334
37 Ga0265323_10002914 3300028653 Bacteria 7663
38 Ga0265323_10007249 3300028653 Bacteria 4621
39 Ga0265323_10018510 3300028653 Bacteria 2695
40 Ga0265322_10015078 3300028654 Unclassified 2234
41 Ga0265336_10000654 3300028666 Bacteria 18860
42 Ga0265338_10000041 3300028800 Bacteria 230676
43 Ga0265338_10001160 3300028800 Bacteria 43556
44 Ga0265338_10001422 3300028800 Bacteria 38883
45 Ga0265338_10001806 3300028800 Bacteria 33663
46 Ga0265338_10002287 3300028800 Bacteria 29181
47 Ga0265338_10003273 3300028800 Bacteria 23015
48 Ga0265338_10008134 3300028800 Bacteria 12800
49 Ga0265338_10008969 3300028800 Bacteria 12030
50 Ga0265338_10016466 3300028800 Bacteria 8043
51 Ga0265338_10027420 3300028800 Bacteria 5715
52 Ga0265338_10030340 3300028800 Bacteria 5329
53 Ga0265338_10114039 3300028800 Bacteria 2170
54 Ga0265324_10016053 3300029957 Bacteria 2743
55 Ga0265324_10040245 3300029957 Bacteria 1619
56 Ga0265320_10000269 3300031240 Bacteria 43090
57 Ga0265320_10056278 3300031240 Bacteria 1890
58 Ga0265340_10003984 3300031247 Bacteria 8301
59 Ga0265339_10005574 3300031249 Bacteria 8361
60 Ga0265327_10022016 3300031251 Unclassified 3827
61 Ga0265327_10143265 3300031251 Bacteria 1115
62 Ga0265316_10002363 3300031344 Bacteria 19648
63 Ga0265316_10005560 3300031344 Bacteria 12218
64 Ga0265316_10008376 3300031344 Bacteria 9602
65 Ga0265316_10102957 3300031344 Bacteria 2168
66 Ga0265313_10004881 3300031595 Bacteria 10058
67 Ga0265313_10017750 3300031595 Unclassified 4026
68 Ga0265314_10023430 3300031711 Bacteria 4707
69 Ga0373930_0000139 3300034816 Bacteria 8118
70 Ga0373928_0000409 3300035084 Bacteria 8552
71 Ga0373940_0006480 3300035088 Unclassified 2598
72 Ga0373944_0002264 3300035089 Unclassified 4895
73 Ga0373949_0001294 3300035090 Bacteria 7263
74 Ga0373932_0000001 3300035112 Bacteria 1459067
75 Ga0373953_0048693 3300035117 Bacteria 1708
76 Ga0373956_0036106 3300035119 Bacteria 2181
77 Ga0373957_0059488 3300035120 Bacteria 1478
78 Ga0373946_0022556 3300035171 Unclassified 2452
79 Ga0373962_0000021 3300035242 Bacteria 43462
80 Ga0373931_0000004 3300035691 Bacteria 535140
81 Ga0373927_0101281 3300035695 Unclassified 1873
82 Ga0373933_0115917 3300035724 Bacteria 1674
83 Ga0373937_0017947 3300036401 Bacteria 6313
84 Ga0373925_0002326 3300037068 Bacteria 15288
85 Ga0453684_0166351 3300044712 Bacteria 2603
86 Ga0451576_0041740 3300045051 Unclassified 4849
87 Ga0451576_0231305 3300045051 Bacteria 1931
88 Ga0495618_0003153 3300046514 Bacteria 10356
89 Ga0495628_0208647 3300046516 Bacteria 1470
90 Ga0495586_0000968 3300046535 Bacteria 16265
91 Ga0495634_0003302 3300046642 Bacteria 13008
92 Ga0495635_0148306 3300046663 Unclassified 1597
93 Ga0495674_0075338 3300047319 Bacteria 2904
94 Ga0495680_0007418 3300047322 Bacteria 10058
95 Ga0501031_0000129 3300049568 Bacteria 42023
96 Ga0501032_0043030 3300049569 Bacteria 3061
97 Ga0501032_0122400 3300049569 Unclassified 1719
98 Ga0501033_0014936 3300049570 Bacteria 5894
99 Ga0501080_0114756 3300049742 Bacteria 2497
100 Ga0501035_0004409 3300049822 Bacteria 13359
101 Ga0501035_0081467 3300049822 Unclassified 2856
102 Ga0501035_0114949 3300049822 Unclassified 2356
103 Ga0501044_0000713 3300049823 Bacteria 40074
104 Ga0501044_0007688 3300049823 Bacteria 11851
105 Ga0265338_10001161
106 rootH2_10022110
107 rootH1_10340113
108 Ga0070690_100001616
109 Ga0070689_100158400
110 Ga0070711_100003213
111 Ga0068855_100033010
112 Ga0068855_100114390
113 Ga0068856_100000102
114 Ga0068856_100019316
115 Ga0081455_10033330
116 Ga0105240_10015748
117 Ga0105240_10556378
118 Ga0105238_10036573
119 Ga0105238_10040550
120 Ga0163163_10478391
121 Ga0207663_10039045
122 Ga0207694_10015291
123 Ga0207694_10019414
124 Ga0207694_10033544
125 Ga0207670_10025505
126 Ga0207667_10052657
127 Ga0207667_10135739
128 Ga0207702_10011578
129 Ga0207702_10016302
130 Ga0207641_10089042
131 Ga0265337_1000023
132 Ga0265337_1001066
133 Ga0265337_1001693
134 Ga0265337_1002135
135 Ga0265337_1008111
136 Ga0265326_10011080
137 Ga0265319_1000027
138 Ga0265319_1026843
139 Ga0265318_10008233
140 Ga0265323_10000043
141 Ga0265323_10002914
142 Ga0265323_10007249
143 Ga0265323_10018510
144 Ga0265322_10015078
145 Ga0265336_10000654
146 Ga0265338_10000041
147 Ga0265338_10001160
148 Ga0265338_10001422
149 Ga0265338_10001806
150 Ga0265338_10002287
151 Ga0265338_10003273
152 Ga0265338_10008134
153 Ga0265338_10008969
154 Ga0265338_10016466
155 Ga0265338_10027420
156 Ga0265338_10030340
157 Ga0265338_10114039
158 Ga0265324_10016053
159 Ga0265324_10040245
160 Ga0265320_10000269
161 Ga0265320_10056278
162 Ga0265340_10003984
163 Ga0265339_10005574
164 Ga0265327_10022016
165 Ga0265327_10143265
166 Ga0265316_10002363
167 Ga0265316_10005560
168 Ga0265316_10008376
169 Ga0265316_10102957
170 Ga0265313_10004881
171 Ga0265313_10017750
172 Ga0265314_10023430
173 Ga0373930_0000139
174 Ga0373928_0000409
175 Ga0373940_0006480
176 Ga0373944_0002264
177 Ga0373949_0001294
178 Ga0373932_0000001
179 Ga0373953_0048693
180 Ga0373956_0036106
181 Ga0373957_0059488
182 Ga0373946_0022556
183 Ga0373962_0000021
184 Ga0373931_0000004
185 Ga0373927_0101281
186 Ga0373933_0115917
187 Ga0373937_0017947
188 Ga0373925_0002326
189 Ga0453684_0166351
190 Ga0451576_0041740
191 Ga0451576_0231305
192 Ga0495618_0003153
193 Ga0495628_0208647
194 Ga0495586_0000968
195 Ga0495634_0003302
196 Ga0495635_0148306
197 Ga0495674_0075338
198 Ga0495680_0007418
199 Ga0501031_0000129
200 Ga0501032_0043030
201 Ga0501032_0122400
202 Ga0501033_0014936
203 Ga0501080_0114756
204 Ga0501035_0004409
205 Ga0501035_0081467
206 Ga0501035_0114949
207 Ga0501044_0000713
208 Ga0501044_0007688

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01075

Glyco_transf_9

Glycosyltransferase family 9 (heptosyltransferase)

71

358

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1f-assembly2.cif.gz_B e. coli heptosyltransferase waac with adp 0.817 1 339
3tov-assembly2.cif.gz_B the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.8163 2 341
3tov-assembly1.cif.gz_A the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.8043 2 340
2h1h-assembly2.cif.gz_B e. coli heptosyltransferase waac with adp-2-deoxy-2-fluoro heptose 0.8 1 341
1psw-assembly1.cif.gz_A structure of e. coli adp-heptose lps heptosyltransferase ii 0.7922 1 341
ID Description Score Start End Superfamily
2h1fB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8883 185 339 3.40.50.2000
af_P25742_1_146_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8352 8 148 3.40.50.2000
1pswA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8306 161 341 3.40.50.2000
3tovB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8261 158 341 3.40.50.2000
1pswA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8126 3 141 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A538P850-F1-model_v4 Glycosyltransferase family 9 protein 0.9435 1 285 GO:0005829
GO:0008713
GO:0009244
AF-A0A538P850-F1-model_v4 Glycosyltransferase family 9 protein 0.9403 1 285 GO:0005829
GO:0008713
GO:0009244
AF-A0A2E5EN22-F1-model_v4 lipopolysaccharide heptosyltransferase II (EC 2.4.99.24) 0.9181 1 342 GO:0005829
GO:0008713
GO:0009244
AF-A0A3D5D6X5-F1-model_v4 Lipopolysaccharide heptosyltransferase II 0.9117 1 341 GO:0005829
GO:0008713
GO:0009244
AF-A0A518B498-F1-model_v4 lipopolysaccharide heptosyltransferase II (EC 2.4.99.24) 0.9064 2 341 GO:0005829
GO:0008713
GO:0009244

Map