F027174

General Info

Members Datasets Scaffolds Average Seq Length
104 41 208 344

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10000946|Ga0265338_1000094611
Length 379
Sequence MKPDQRISIKDYECPFAIIGVLWDRKCVTPSGTLDNSYMTDPQWNDLLAVLRGEVLRPRPVGFIIDCPWLPGWCGKDIADYLSSETLWFEANRKAIETFPDVWFLPGFWSEFGMCTEPSAFGSRCAFPRNEFPFADKIIAEVGQIADLKVPDPATDGLLPFMLNRLRWAQPRIEDLGHKIRFSVSRGPLNVATFLMGTTEFLMALKTDPQPVHRLLRVVTDFLKQWHALQRGTFPTIDGMLMLDDIVGFMGENDFVEFGLPYLRELYDVKVAVKFFHNDAPCAKSIKYYPDLGINLYNPGVQTPLTGMRQLSGNRLTILGNIPPRDVLAQGAPDDVRAAVKKLLAEAGDPSRLILSCGGGVPPGVTTANLRAFVQAARE

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
3 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
4 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
5 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
6 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
7 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
8 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
9 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
10 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
11 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
12 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
13 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
14 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
15 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
16 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
17 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
18 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
19 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
20 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
21 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
22 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
23 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
24 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
25 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
26 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
27 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
28 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
29 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
30 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
31 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
32 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
33 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
34 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
35 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
36 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
37 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
38 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
39 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
40 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
41 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.04
Stem 0
Stem Tuber 0
Unclassified 6.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10000946 3300028800 Bacteria 48852
2 Ga0105237_10193872 3300009545 Bacteria 2031
3 Ga0157371_10045018 3300013102 Bacteria 3141
4 Ga0265337_1007576 3300028556 Bacteria 4050
5 Ga0265326_10010327 3300028558 Bacteria 2770
6 Ga0265319_1007414 3300028563 Bacteria 4937
7 Ga0265334_10007145 3300028573 Bacteria 4792
8 Ga0265318_10003007 3300028577 Bacteria 8698
9 Ga0265318_10061267 3300028577 Bacteria 1402
10 Ga0265323_10001408 3300028653 Bacteria 11846
11 Ga0265323_10014229 3300028653 Unclassified 3156
12 Ga0265323_10075669 3300028653 Unclassified 1143
13 Ga0265322_10001436 3300028654 Bacteria 7825
14 Ga0265336_10004225 3300028666 Bacteria 5462
15 Ga0265338_10000210 3300028800 Bacteria 107885
16 Ga0265338_10000220 3300028800 Bacteria 106037
17 Ga0265338_10002539 3300028800 Bacteria 27061
18 Ga0265338_10003530 3300028800 Bacteria 21897
19 Ga0265338_10014385 3300028800 Bacteria 8807
20 Ga0265338_10015612 3300028800 Bacteria 8322
21 Ga0265338_10020517 3300028800 Bacteria 6948
22 Ga0265338_10025386 3300028800 Bacteria 6013
23 Ga0265324_10000164 3300029957 Bacteria 51170
24 Ga0265324_10041827 3300029957 Bacteria 1585
25 Ga0265330_10000613 3300031235 Bacteria 23004
26 Ga0265330_10010980 3300031235 Bacteria 4255
27 Ga0265332_10012004 3300031238 Bacteria 3847
28 Ga0265328_10002810 3300031239 Bacteria 7792
29 Ga0265320_10031143 3300031240 Bacteria 2743
30 Ga0265325_10002940 3300031241 Bacteria 11342
31 Ga0265340_10000051 3300031247 Bacteria 54481
32 Ga0265340_10001091 3300031247 Bacteria 15463
33 Ga0265340_10031438 3300031247 Bacteria 2654
34 Ga0265339_10002020 3300031249 Bacteria 14913
35 Ga0265331_10043648 3300031250 Bacteria 2170
36 Ga0265316_10007129 3300031344 Bacteria 10569
37 Ga0265316_10019251 3300031344 Bacteria 5843
38 Ga0265316_10055452 3300031344 Bacteria 3099
39 Ga0265316_10084292 3300031344 Bacteria 2434
40 Ga0265316_10117050 3300031344 Unclassified 2015
41 Ga0265316_10226472 3300031344 Bacteria 1378
42 Ga0265313_10001333 3300031595 Bacteria 23236
43 Ga0265313_10011260 3300031595 Bacteria 5572
44 Ga0265314_10000552 3300031711 Bacteria 47809
45 Ga0265314_10084093 3300031711 Bacteria 2090
46 Ga0265342_10005055 3300031712 Bacteria 10169
47 Ga0265342_10041715 3300031712 Unclassified 2776
48 Ga0265342_10092395 3300031712 Bacteria 1733
49 Ga0316576_10010409 3300031727 Bacteria 6041
50 Ga0316577_10027070 3300031733 Bacteria 3196
51 Ga0316583_10014855 3300032133 Bacteria 2804
52 Ga0373951_0008236 3300035091 Unclassified 2360
53 Ga0316584_0000969 3300036712 Bacteria 16423
54 Ga0400489_15485 3300039093 Bacteria 13028
55 Ga0451577_0000943 3300042876 Bacteria 42647
56 Ga0451577_0003821 3300042876 Bacteria 16397
57 Ga0451577_0016000 3300042876 Bacteria 6959
58 Ga0451577_0026645 3300042876 Bacteria 5235
59 Ga0451577_0079252 3300042876 Bacteria 2928
60 Ga0451577_0142664 3300042876 Bacteria 2153
61 Ga0453683_0000311 3300044673 Bacteria 61262
62 Ga0453683_0000504 3300044673 Bacteria 44527
63 Ga0453683_0006188 3300044673 Bacteria 8234
64 Ga0453683_0009591 3300044673 Bacteria 6457
65 Ga0453684_0000001 3300044712 Bacteria 2623166
66 Ga0453684_0000919 3300044712 Bacteria 97826
67 Ga0453684_0001039 3300044712 Bacteria 88840
68 Ga0453684_0002828 3300044712 Bacteria 40931
69 Ga0453684_0004244 3300044712 Bacteria 30652
70 Ga0453684_0006697 3300044712 Bacteria 21740
71 Ga0453684_0008831 3300044712 Bacteria 17871
72 Ga0453684_0009208 3300044712 Bacteria 17346
73 Ga0453684_0012786 3300044712 Bacteria 13768
74 Ga0453684_0014688 3300044712 Bacteria 12485
75 Ga0453684_0021053 3300044712 Bacteria 9775
76 Ga0453684_0045669 3300044712 Bacteria 5838
77 Ga0453684_0053728 3300044712 Bacteria 5255
78 Ga0453684_0055819 3300044712 Bacteria 5131
79 Ga0453684_0069794 3300044712 Bacteria 4455
80 Ga0453684_0105694 3300044712 Bacteria 3433
81 Ga0453684_0118888 3300044712 Bacteria 3195
82 Ga0453684_0212814 3300044712 Bacteria 2245
83 Ga0453684_0214576 3300044712 Bacteria 2234
84 Ga0453684_0250085 3300044712 Bacteria 2036
85 Ga0453684_0290152 3300044712 Bacteria 1863
86 Ga0453684_0392447 3300044712 Bacteria 1556
87 Ga0451576_0001065 3300045051 Bacteria 50428
88 Ga0451576_0001214 3300045051 Bacteria 45916
89 Ga0451576_0001257 3300045051 Bacteria 44542
90 Ga0451576_0003190 3300045051 Bacteria 22890
91 Ga0451576_0016624 3300045051 Bacteria 8115
92 Ga0451576_0025793 3300045051 Bacteria 6331
93 Ga0451576_0081475 3300045051 Unclassified 3366
94 Ga0451576_0195451 3300045051 Bacteria 2113
95 Ga0451576_0296080 3300045051 Bacteria 1692
96 Ga0451576_0392975 3300045051 Bacteria 1454
97 Ga0451576_0500100 3300045051 Unclassified 1277
98 Ga0501041_0078336 3300049577 Bacteria 2034
99 Ga0501048_0040302 3300049582 Bacteria 3348
100 Ga0501071_0005492 3300049587 Bacteria 8158
101 Ga0501075_0112882 3300049591 Bacteria 2066
102 Ga0501076_0013105 3300049592 Bacteria 6208
103 Ga0501080_0021959 3300049742 Bacteria 5912
104 Ga0530510_0237678 3300061734 Bacteria 1356
105 Ga0265338_10000946
106 Ga0105237_10193872
107 Ga0157371_10045018
108 Ga0265337_1007576
109 Ga0265326_10010327
110 Ga0265319_1007414
111 Ga0265334_10007145
112 Ga0265318_10003007
113 Ga0265318_10061267
114 Ga0265323_10001408
115 Ga0265323_10014229
116 Ga0265323_10075669
117 Ga0265322_10001436
118 Ga0265336_10004225
119 Ga0265338_10000210
120 Ga0265338_10000220
121 Ga0265338_10002539
122 Ga0265338_10003530
123 Ga0265338_10014385
124 Ga0265338_10015612
125 Ga0265338_10020517
126 Ga0265338_10025386
127 Ga0265324_10000164
128 Ga0265324_10041827
129 Ga0265330_10000613
130 Ga0265330_10010980
131 Ga0265332_10012004
132 Ga0265328_10002810
133 Ga0265320_10031143
134 Ga0265325_10002940
135 Ga0265340_10000051
136 Ga0265340_10001091
137 Ga0265340_10031438
138 Ga0265339_10002020
139 Ga0265331_10043648
140 Ga0265316_10007129
141 Ga0265316_10019251
142 Ga0265316_10055452
143 Ga0265316_10084292
144 Ga0265316_10117050
145 Ga0265316_10226472
146 Ga0265313_10001333
147 Ga0265313_10011260
148 Ga0265314_10000552
149 Ga0265314_10084093
150 Ga0265342_10005055
151 Ga0265342_10041715
152 Ga0265342_10092395
153 Ga0316576_10010409
154 Ga0316577_10027070
155 Ga0316583_10014855
156 Ga0373951_0008236
157 Ga0316584_0000969
158 Ga0400489_15485
159 Ga0451577_0000943
160 Ga0451577_0003821
161 Ga0451577_0016000
162 Ga0451577_0026645
163 Ga0451577_0079252
164 Ga0451577_0142664
165 Ga0453683_0000311
166 Ga0453683_0000504
167 Ga0453683_0006188
168 Ga0453683_0009591
169 Ga0453684_0000001
170 Ga0453684_0000919
171 Ga0453684_0001039
172 Ga0453684_0002828
173 Ga0453684_0004244
174 Ga0453684_0006697
175 Ga0453684_0008831
176 Ga0453684_0009208
177 Ga0453684_0012786
178 Ga0453684_0014688
179 Ga0453684_0021053
180 Ga0453684_0045669
181 Ga0453684_0053728
182 Ga0453684_0055819
183 Ga0453684_0069794
184 Ga0453684_0105694
185 Ga0453684_0118888
186 Ga0453684_0212814
187 Ga0453684_0214576
188 Ga0453684_0250085
189 Ga0453684_0290152
190 Ga0453684_0392447
191 Ga0451576_0001065
192 Ga0451576_0001214
193 Ga0451576_0001257
194 Ga0451576_0003190
195 Ga0451576_0016624
196 Ga0451576_0025793
197 Ga0451576_0081475
198 Ga0451576_0195451
199 Ga0451576_0296080
200 Ga0451576_0392975
201 Ga0451576_0500100
202 Ga0501041_0078336
203 Ga0501048_0040302
204 Ga0501071_0005492
205 Ga0501075_0112882
206 Ga0501076_0013105
207 Ga0501080_0021959
208 Ga0530510_0237678

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

46

379

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ay8-assembly2.cif.gz_B semet-derivative of a methyltransferase from m. mazei 0.8554 7 344
4ay8-assembly2.cif.gz_B semet-derivative of a methyltransferase from m. mazei 0.8346 7 344
4zr8-assembly1.cif.gz_A structure of uroporphyrinogen decarboxylase from acinetobacter baumannii 0.8198 8 343
6w2o-assembly1.cif.gz_A crystal structure of uroporphyrinogen iii decarboxylate (heme) from stenotrophomonas maltophilia 0.8185 8 343
4zr8-assembly1.cif.gz_B structure of uroporphyrinogen decarboxylase from acinetobacter baumannii 0.8161 8 343
ID Description Score Start End Superfamily
4ay8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8394 7 344 3.20.20.210
4ay8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8208 7 344 3.20.20.210
2infD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.811 7 343 3.20.20.210
af_C6TEE8_35_387_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8034 9 341 3.20.20.210
af_P32347_4_362_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8009 7 343 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A7C1DKY6-F1-model_v4 Uroporphyrinogen decarboxylase 0.9889 1 341 GO:0004853
GO:0006779
AF-A0A7V4CV08-F1-model_v4 Uroporphyrinogen decarboxylase 0.9878 1 341 GO:0004853
GO:0006779
AF-A0A7X9HQ79-F1-model_v4 Uroporphyrinogen decarboxylase 0.9877 42 341 GO:0004853
GO:0006779
AF-A0A081BMM7-F1-model_v4 Uroporphyrinogen decarboxylase, URO-D 0.9876 1 341 GO:0004853
GO:0006779
AF-A0A7J5E6X0-F1-model_v4 Uroporphyrinogen decarboxylase 0.9871 1 278 GO:0004853
GO:0006779

Map