F025760

General Info

Members Datasets Scaffolds Average Seq Length
104 77 71 263

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10287476|Ga0075365_102874761
Length 274
Sequence MNPIERHTVDLGISGRIALVTGGDSGIGWHTARLLLEEGATVVLSDRDQDSLDEAAAKLDAPKKRLHAIAADLDSVESIFALRDAVAEAVGDIDILVQSAGVTGAQGLFHEIDDAGWVDTLTTDLLAPIRLTRAFLPALRSGGWGRAVYLASEDAVQPYDDELPYCAAKAGILAFAKGLSRTYAKEGLLVNCVSPAFISTPMTDAMMEKRAKQLGTDTDQAIESFLDEERPYMELGRRGEPEEVAAVVAFLCSDLASFVNGSNYRVDSGSVATI

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221572 Leifsonia sp. Root60 Isolate Unclassified
3 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
4 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
5 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
6 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
7 2739367898 Nocardioides sp. CF479 Isolate Unclassified
8 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
9 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
10 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
11 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
12 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
13 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
14 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
15 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
16 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
17 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
18 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
19 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
20 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
21 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
22 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
23 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
24 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
25 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
26 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
27 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
28 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
29 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
30 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
31 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
32 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
33 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
51 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
52 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
53 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
54 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
55 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
56 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
57 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
58 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
59 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
60 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
61 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
62 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
63 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
64 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
65 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
66 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
67 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
68 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
70 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
71 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
72 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
73 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
74 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
75 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
76 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
77 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.31
Metatranscriptomes 0.96
Isolates 31.73

Biome Distribution

Category Percentage (%)
Aerial Root 3.85
Bulb 0
Endosphere 24.04
Nodule 0
Rhizoplane 1.92
Rhizosphere 32.69
Stem 0
Stem Tuber 0
Unclassified 37.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10097674 3300003323 Bacteria 5102
2 Ga0070710_10115722 3300005437 Bacteria 1616
3 Ga0068855_100304583 3300005563 Unclassified 1764
4 Ga0075365_10100438 3300006038 Bacteria 1980
5 Ga0075365_10287476 3300006038 Bacteria 1157
6 Ga0075363_100060256 3300006048 Bacteria 2042
7 Ga0075364_10027619 3300006051 Bacteria 3627
8 Ga0075364_10054607 3300006051 Bacteria 2612
9 Ga0075364_10256786 3300006051 Bacteria 1188
10 Ga0075369_10023488 3300006186 Bacteria 2549
11 Ga0068865_100453827 3300006881 Bacteria 1060
12 Ga0105244_10110490 3300009036 Bacteria 1338
13 Ga0157373_10234958 3300013100 Unclassified 1295
14 Ga0182008_10001009 3300014497 Bacteria 19553
15 Ga0207692_10157344 3300025898 Bacteria 1307
16 Ga0209974_10002554 3300027876 Bacteria 6603
17 Ga0307515_10444589 3300028794 Bacteria 913
18 Ga0307514_10005865 3300031649 Bacteria 10841
19 Ga0395900_0617454 3300037418 Bacteria 1023
20 Ga0466961_0172538 3300044693 Bacteria 1345
21 Ga0466970_0049865 3300044765 Bacteria 2232
22 Ga0466970_0090782 3300044765 Bacteria 1657
23 Ga0466958_0265207 3300045836 Bacteria 1100
24 Ga0495607_0193836 3300046501 Bacteria 1010
25 Ga0495609_0042224 3300046538 Unclassified 2048
26 Ga0495626_0032363 3300048091 Bacteria 2512
27 Ga0496109_0001113 3300048912 Bacteria 22299
28 Ga0496113_0169445 3300048916 Bacteria 1729
29 Ga0496116_0138232 3300048919 Bacteria 1375
30 Ga0496117_0000048 3300048920 Bacteria 295908
31 Ga0496117_0075172 3300048920 Bacteria 2245
32 Ga0496117_0144603 3300048920 Bacteria 1418
33 Ga0496118_0012851 3300048921 Bacteria 7986
34 Ga0496119_0002379 3300048922 Bacteria 20665
35 Ga0496119_0064814 3300048922 Bacteria 2167
36 Ga0496120_0000614 3300048923 Bacteria 53949
37 Ga0496120_0021796 3300048923 Bacteria 4040
38 Ga0496121_0032642 3300048924 Bacteria 4729
39 Ga0496121_0249085 3300048924 Bacteria 1233
40 Ga0496122_0000338 3300048925 Bacteria 101772
41 Ga0496122_0000427 3300048925 Bacteria 88913
42 Ga0496122_0008022 3300048925 Bacteria 11527
43 Ga0496122_0073239 3300048925 Bacteria 2430
44 Ga0496122_0115247 3300048925 Bacteria 1751
45 Ga0496123_0000031 3300048926 Bacteria 287596
46 Ga0496123_0001011 3300048926 Bacteria 42966
47 Ga0496123_0073336 3300048926 Bacteria 2124
48 Ga0496124_0002673 3300048927 Bacteria 22841
49 Ga0496124_0075398 3300048927 Bacteria 2786
50 Ga0496124_0200788 3300048927 Bacteria 1516
51 Ga0496125_0001134 3300048928 Bacteria 40533
52 Ga0496125_0265884 3300048928 Bacteria 1072
53 Ga0501310_000054 3300049130 Bacteria 10739
54 nmdc:mga00v17_24187_c1 3300050491 Bacteria 3521
55 nmdc:mga00v17_9163_c1 3300050491 Bacteria 5343
56 nmdc:mga0yw44_66599_c1 3300050492 Bacteria 2223
57 nmdc:mga0sz30_27291_c1 3300050516 Bacteria 2344
58 Ga0500635_0000016 3300053080 Bacteria 124879
59 Ga0500591_094157 3300053115 Bacteria 1299
60 Ga0500559_0000115 3300053136 Bacteria 63289
61 Ga0500559_0000220 3300053136 Bacteria 45779
62 Ga0500559_0013659 3300053136 Bacteria 3435
63 Ga0500559_0030139 3300053136 Bacteria 2325
64 Ga0500573_0001361 3300053140 Bacteria 11634
65 Ga0500573_0008210 3300053140 Bacteria 5744
66 Ga0500573_0020518 3300053140 Bacteria 3786
67 Ga0500573_0020996 3300053140 Bacteria 3741
68 Ga0500573_0027878 3300053140 Bacteria 3249
69 Ga0500573_0037738 3300053140 Bacteria 2792
70 Ga0500616_0000216 3300053153 Bacteria 90400
71 Ga0500624_003584 3300053157 Bacteria 2032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053140 Ga0500573_0027878 Ga0500573_0027878_137_862 241
2 3300046501 Ga0495607_0193836 Ga0495607_0193836_236_991 248
3 3300009036 Ga0105244_10110490 Ga0105244_101104902 251
4 3300013100 Ga0157373_10234958 Ga0157373_102349582 251
5 3300046538 Ga0495609_0042224 Ga0495609_0042224_229_1038 251
6 3300006048 Ga0075363_100060256 Ga0075363_1000602562 253
7 3300050491 nmdc:mga00v17_24187_c1 nmdc:mga00v17_24187_c1_2263_3063 253
8 3300048924 Ga0496121_0249085 Ga0496121_0249085_230_1012 260
9 iso_pu_bacteria 2739367898 2740167950 260
10 3300048922 Ga0496119_0002379 Ga0496119_0002379_3516_4304 262
11 3300048923 Ga0496120_0021796 Ga0496120_0021796_2136_2924 262
12 3300048924 Ga0496121_0032642 Ga0496121_0032642_3273_4061 262
13 3300048928 Ga0496125_0265884 Ga0496125_0265884_239_1030 262
14 3300053136 Ga0500559_0000115 Ga0500559_0000115_14757_15545 262
15 3300053140 Ga0500573_0020996 Ga0500573_0020996_419_1207 262
16 iso_pu_bacteria 2585428157 2588108359 262
17 iso_pu_bacteria 2643221572 2643876073 262
18 iso_pu_bacteria 2643221632 2644182608 262
19 iso_pu_bacteria 2643221669 2644383128 262
20 iso_pu_bacteria 2643221681 2644456019 262
21 iso_pu_bacteria 2808606306 2808630575 262
22 iso_pu_bacteria 2844852863 2844854119 262
23 iso_pu_bacteria 2852677369 2852679208 262
24 iso_pu_bacteria 2857481737 2857483020 262
25 iso_pu_bacteria 2857729791 2857733244 262
26 iso_pu_bacteria 2870622029 2870623730 262
27 iso_pu_bacteria 2904430863 2904433932 262
28 iso_pu_bacteria 2904445276 2904445989 262
29 iso_pu_bacteria 2904501621 2904502392 262
30 iso_pu_bacteria 2904765812 2904768048 262
31 iso_pu_bacteria 2904770941 2904776026 262
32 iso_pu_bacteria 2908674828 2908677403 262
33 iso_pu_bacteria 2908811453 2908815349 262
34 iso_pu_bacteria 2909074476 2909076040 262
35 iso_pu_bacteria 2919039151 2919041897 262
36 iso_pu_bacteria 2919042368 2919045216 262
37 iso_pu_bacteria 2919420072 2919423521 262
38 iso_pu_bacteria 2919432681 2919436129 262
39 iso_pu_bacteria 2928500415 2928503574 262
40 iso_pu_bacteria 2939657138 2939658166 262
41 iso_pu_bacteria 2966921586 2966923105 262
42 iso_pu_bacteria 2974315732 2974319546 262
43 iso_pu_bacteria 2984523437 2984527753 262
44 iso_pu_bacteria 2984551494 2984552622 262
45 iso_pu_bacteria 2984576629 2984577799 262
46 iso_pu_bacteria 2990256926 2990260230 262
47 3300005437 Ga0070710_10115722 Ga0070710_101157222 263
48 3300025898 Ga0207692_10157344 Ga0207692_101573442 263
49 3300028794 Ga0307515_10444589 Ga0307515_104445891 263
50 3300031649 Ga0307514_10005865 Ga0307514_100058658 263
51 3300053153 Ga0500616_0000216 Ga0500616_0000216_88882_89673 263
52 iso_pu_bacteria 2728369276 2729908084 263
53 3300006051 Ga0075364_10256786 Ga0075364_102567862 265
54 3300037418 Ga0395900_0617454 Ga0395900_0617454_101_898 265
55 3300044693 Ga0466961_0172538 Ga0466961_0172538_483_1280 265
56 3300045836 Ga0466958_0265207 Ga0466958_0265207_234_1031 265
57 3300053080 Ga0500635_0000016 Ga0500635_0000016_10385_11194 265
58 3300003323 rootH1_10097674 rootH1_100976744 266
59 3300005563 Ga0068855_100304583 Ga0068855_1003045832 266
60 3300006038 Ga0075365_10100438 Ga0075365_101004382 266
61 3300006038 Ga0075365_10287476 Ga0075365_102874761 266
62 3300006051 Ga0075364_10027619 Ga0075364_100276194 266
63 3300006051 Ga0075364_10054607 Ga0075364_100546072 266
64 3300006186 Ga0075369_10023488 Ga0075369_100234883 266
65 3300006881 Ga0068865_100453827 Ga0068865_1004538271 266
66 3300014497 Ga0182008_10001009 Ga0182008_100010099 266
67 3300027876 Ga0209974_10002554 Ga0209974_100025544 266
68 3300044765 Ga0466970_0049865 Ga0466970_0049865_213_1013 266
69 3300044765 Ga0466970_0090782 Ga0466970_0090782_222_1022 266
70 3300048091 Ga0495626_0032363 Ga0495626_0032363_1082_1882 266
71 3300048912 Ga0496109_0001113 Ga0496109_0001113_9040_9840 266
72 3300048916 Ga0496113_0169445 Ga0496113_0169445_496_1296 266
73 3300048919 Ga0496116_0138232 Ga0496116_0138232_141_941 266
74 3300048920 Ga0496117_0000048 Ga0496117_0000048_37447_38247 266
75 3300048920 Ga0496117_0075172 Ga0496117_0075172_1011_1811 266
76 3300048920 Ga0496117_0144603 Ga0496117_0144603_475_1275 266
77 3300048921 Ga0496118_0012851 Ga0496118_0012851_2523_3323 266
78 3300048922 Ga0496119_0064814 Ga0496119_0064814_734_1534 266
79 3300048923 Ga0496120_0000614 Ga0496120_0000614_24404_25204 266
80 3300048925 Ga0496122_0000338 Ga0496122_0000338_65924_66724 266
81 3300048925 Ga0496122_0000427 Ga0496122_0000427_76137_76937 266
82 3300048925 Ga0496122_0008022 Ga0496122_0008022_7501_8301 266
83 3300048925 Ga0496122_0073239 Ga0496122_0073239_1222_2022 266
84 3300048925 Ga0496122_0115247 Ga0496122_0115247_724_1524 266
85 3300048926 Ga0496123_0000031 Ga0496123_0000031_267037_267837 266
86 3300048926 Ga0496123_0001011 Ga0496123_0001011_42070_42870 266
87 3300048926 Ga0496123_0073336 Ga0496123_0073336_669_1469 266
88 3300048927 Ga0496124_0002673 Ga0496124_0002673_16081_16881 266
89 3300048927 Ga0496124_0075398 Ga0496124_0075398_796_1596 266
90 3300048927 Ga0496124_0200788 Ga0496124_0200788_470_1270 266
91 3300048928 Ga0496125_0001134 Ga0496125_0001134_18479_19279 266
92 3300049130 Ga0501310_000054 Ga0501310_000054_1519_2319 266
93 3300050491 nmdc:mga00v17_9163_c1 nmdc:mga00v17_9163_c1_3460_4260 266
94 3300050492 nmdc:mga0yw44_66599_c1 nmdc:mga0yw44_66599_c1_1243_2043 266
95 3300050516 nmdc:mga0sz30_27291_c1 nmdc:mga0sz30_27291_c1_1297_2097 266
96 3300053115 Ga0500591_094157 Ga0500591_094157_191_991 266
97 3300053136 Ga0500559_0000220 Ga0500559_0000220_328_1128 266
98 3300053136 Ga0500559_0013659 Ga0500559_0013659_1716_2516 266
99 3300053136 Ga0500559_0030139 Ga0500559_0030139_1233_2033 266
100 3300053140 Ga0500573_0001361 Ga0500573_0001361_9593_10393 266
101 3300053140 Ga0500573_0008210 Ga0500573_0008210_4664_5464 266
102 3300053140 Ga0500573_0020518 Ga0500573_0020518_1038_1838 266
103 3300053140 Ga0500573_0037738 Ga0500573_0037738_1115_1915 266
104 3300053157 Ga0500624_003584 Ga0500624_003584_1162_1962 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

16

211

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

22

271

0.89

PF08659

KR

KR domain

17

192

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hs5-assembly1.cif.gz_A brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant: 1-53 truncation-i258m/k262t-nad+ 0.9281 1 261
6jha-assembly1.cif.gz_B-2 crystal structure of nadph bound aerf from microcystis aeruginosa 0.9271 1 261
5t2u-assembly1.cif.gz_B short chain dehydrogenase/reductase family protein 0.9269 5 265
6jh7-assembly1.cif.gz_B-2 crystal structure of aerf from microcystis aeruginosa 0.9255 1 261
6jha-assembly1.cif.gz_A-2 crystal structure of nadph bound aerf from microcystis aeruginosa 0.9253 1 261
ID Description Score Start End Superfamily
af_K7MUD1_29_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9308 8 88 3.40.50.720
5t2uB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9269 5 265 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9258 5 188 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9224 8 92 3.40.50.720
5k9zA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9157 5 261 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4R3U734-F1-model_v4 deleted 0.9811 1 176
AF-A0A4R3U734-F1-model_v4 deleted 0.9701 1 176
AF-A0A6M8VFF9-F1-model_v4 SDR family oxidoreductase 0.9382 8 261 GO:0016491
AF-A0A1F7NT96-F1-model_v4 Short-chain dehydrogenase 0.9379 1 266
AF-A0A327YMZ6-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9371 1 263 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.99 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map