F023569

General Info

Members Datasets Scaffolds Average Seq Length
103 93 206 410

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2842363717|2842369495
Length 436
Sequence ATLSQETKRENGKMLLGVIADDFTGAGDIANTIAKGLPGQGGLRTVQYLGIPPKAAAGDVEAGVISLKSRSVDAAIAVKQSLDALRWLLDQGCEQIVFKYCSTFDSTPAGNIGPVGEALAEALGVKGVVACPAFPEAGRTVYQGHLFVKDRLLSESGLQNHPLNPMTDADLRRWLRLQTSSDVGHVDIATVRKGSQAIEAALRRNGEEERVLVIVDAVTDSDLVAIGRAAAAHRLVTGGSGVALGLAANFVERGLARGTDTASLGVDGPEAILAGSCSGATREQVEIHGRNHPILAIDVAGVMDGKVAISDLTSFLLANRGRAPLVYSSGSPDEVQAIQARFGREKVAKALDRLFADTAQALIGAGIRRLVVAGGETSGAVVSALDLGALTIGPEIDPGVPVLISNGDAPVALALKSGNFGALDFFSKALQRLSGR

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
3 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
4 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
5 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
6 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
7 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
8 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
9 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
10 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
11 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
13 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
14 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
18 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
19 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
20 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
21 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
22 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
23 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
24 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
25 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
26 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
27 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
28 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
29 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
30 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
31 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
32 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
33 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
34 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
35 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
36 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
37 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
38 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
39 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
40 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
41 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
42 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
43 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
44 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
45 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
46 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
47 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
49 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
50 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
51 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
52 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
53 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
54 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
55 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
56 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
57 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
58 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
59 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
60 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
61 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
62 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
63 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
64 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
65 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
66 2643221557 Ensifer sp. Root558 Isolate Unclassified
67 2643221688 Rhizobium sp. Root482 Isolate Unclassified
68 2738541293 Rhizobium sp. GV031 Isolate Unclassified
69 2791355261 Rhizobium sp. J15 Isolate Nodule
70 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
71 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
72 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
73 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
74 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
75 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
76 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
77 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
78 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
79 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
80 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
81 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
82 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
83 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
84 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
85 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
86 2996893221 Rhizobium sp. R635 Isolate Nodule
87 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
88 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
89 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
90 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
91 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
92 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
93 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 62.14
Metatranscriptomes 0
Isolates 37.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.74
Nodule 20.39
Rhizoplane 2.91
Rhizosphere 36.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10021612 3300003187 Bacteria 2688
2 Ga0055542_1002916 3300003762 Bacteria 5044
3 Ga0070678_100100126 3300005456 Bacteria 2244
4 Ga0070665_100061178 3300005548 Bacteria 3774
5 Ga0079104_1000014 3300006946 Bacteria 337362
6 Ga0171463_1002 3300013249 Bacteria 1274851
7 Ga0157372_10022249 3300013307 Bacteria 6860
8 Ga0183363_1127 3300015690 Bacteria 19257
9 Ga0213873_10015708 3300021358 Bacteria 1701
10 Ga0213876_10008716 3300021384 Bacteria 5481
11 Ga0209148_1000345 3300025254 Bacteria 61005
12 Ga0209129_1002679 3300025258 Bacteria 8410
13 Ga0209233_1003310 3300025261 Bacteria 5712
14 Ga0207660_10188568 3300025917 Bacteria 1604
15 Ga0207668_10135136 3300025972 Bacteria 1889
16 Ga0207683_10126792 3300026121 Bacteria 2294
17 Ga0209281_1000032 3300027111 Bacteria 401727
18 Ga0307515_10082890 3300028794 Bacteria 4140
19 Ga0265331_10040834 3300031250 Bacteria 2256
20 Ga0307513_10166365 3300031456 Bacteria 2089
21 Ga0265314_10032093 3300031711 Bacteria 3868
22 Ga0307405_10001547 3300031731 Bacteria 9747
23 Ga0307406_10051963 3300031901 Bacteria 2604
24 Ga0307412_10003058 3300031911 Bacteria 9276
25 Ga0307414_10096069 3300032004 Bacteria 2216
26 Ga0395900_0384437 3300037418 Bacteria 1371
27 Ga0395898_0124343 3300037466 Bacteria 2471
28 Ga0395905_0000972 3300037471 Bacteria 36749
29 Ga0395905_0002565 3300037471 Bacteria 20011
30 Ga0436364_1150303 3300037853 Bacteria 9890
31 Ga0436364_1471961 3300037853 Bacteria 4187
32 Ga0436365_0109783 3300039437 Bacteria 28002
33 Ga0436363_0979682 3300039450 Bacteria 10471
34 Ga0436362_1212516 3300039453 Bacteria 6785
35 Ga0439438_008454 3300041405 Bacteria 3410
36 Ga0439447_010663 3300041407 Bacteria 2718
37 Ga0495638_0029760 3300046460 Bacteria 3521
38 Ga0495654_0000043 3300046530 Bacteria 161913
39 Ga0495686_0057023 3300047472 Bacteria 2439
40 Ga0496106_0002048 3300048909 Bacteria 15151
41 Ga0496106_0077636 3300048909 Bacteria 2547
42 Ga0496116_0011416 3300048919 Bacteria 7355
43 Ga0496116_0024714 3300048919 Bacteria 4434
44 Ga0496116_0055189 3300048919 Bacteria 2611
45 Ga0496118_0119303 3300048921 Bacteria 1725
46 Ga0496121_0012931 3300048924 Bacteria 9023
47 Ga0496121_0015360 3300048924 Bacteria 8031
48 Ga0496122_0086039 3300048925 Bacteria 2166
49 Ga0496124_0007824 3300048927 Bacteria 11281
50 Ga0496124_0036788 3300048927 Bacteria 4264
51 Ga0496124_0089643 3300048927 Bacteria 2511
52 Ga0496126_0010537 3300048929 Bacteria 9679
53 Ga0501032_0010228 3300049569 Bacteria 6770
54 Ga0501043_0103723 3300049579 Bacteria 2234
55 Ga0501046_0109454 3300049580 Bacteria 2112
56 Ga0501047_0112457 3300049581 Bacteria 2605
57 Ga0501067_0144154 3300049583 Bacteria 1327
58 Ga0501068_0013555 3300049584 Bacteria 4641
59 Ga0501083_0045142 3300049744 Bacteria 2981
60 Ga0500618_000008 3300053125 Bacteria 214678
61 Ga0500618_000527 3300053125 Bacteria 23980
62 Ga0500568_0001485 3300053139 Bacteria 14998
63 Ga0500604_0000189 3300053151 Bacteria 17554
64 Ga0501082_0056554 3300060353 Bacteria 3380
65 2842369495 2842363717 Bacteria 6844742
66 2509388208 2509276021 Bacteria 7634384
67 2511197875 2510917030 Bacteria 7460662
68 2512531452 2512047086 Bacteria 6850303
69 2513635729 2513237093 Bacteria 7545552
70 2515610726 2515154107 Bacteria 6795637
71 2561469389 2558860983 Bacteria 4133860
72 2585225435 2582581298 Bacteria 7315509
73 2585548290 2585427529 Bacteria 7395659
74 2586004327 2585427634 Bacteria 6455027
75 2643806364 2643221557 Bacteria 7184309
76 2644494868 2643221688 Bacteria 5260751
77 2644495715 2643221688 Bacteria 5260751
78 2738805302 2738541293 Bacteria 7065685
79 2793329379 2791355261 Bacteria 6661293
80 2819683487 2818991461 Bacteria 7026071
81 2821130661 2821123053 Bacteria 7836056
82 2838079854 2838074704 Bacteria 6785777
83 2842342869 2842341865 Bacteria 7003929
84 2857536076 2857531043 Bacteria 6754041
85 2876770308 2876761206 Bacteria 10111113
86 2882459333 2882456835 Bacteria 6863978
87 2908673347 2908669403 Bacteria 5740494
88 2913298960 2913295892 Bacteria 6333755
89 2924762226 2924754689 Bacteria 6774424
90 2936368289 2936367885 Bacteria 7324495
91 2936376122 2936375103 Bacteria 6652732
92 2957445154 2957443900 Bacteria 6869977
93 2960619858 2960617483 Bacteria 6727748
94 2960661819 2960660292 Bacteria 7041660
95 2977525414 2977523885 Bacteria 6960446
96 2996895365 2996893221 Bacteria 5823108
97 3002141257 3002141150 Bacteria 5254435
98 3003934291 3003930520 Bacteria 5667563
99 3005446591 3005445848 Bacteria 6906074
100 8001848566 8001845381 Bacteria 5804942
101 8005376778 8005376324 Bacteria 6590079
102 8045866939 8045864390 Bacteria 5043873
103 8057136050 8057132660 Bacteria 4061191
104 JGI25151J46595_10021612
105 Ga0055542_1002916
106 Ga0070678_100100126
107 Ga0070665_100061178
108 Ga0079104_1000014
109 Ga0171463_1002
110 Ga0157372_10022249
111 Ga0183363_1127
112 Ga0213873_10015708
113 Ga0213876_10008716
114 Ga0209148_1000345
115 Ga0209129_1002679
116 Ga0209233_1003310
117 Ga0207660_10188568
118 Ga0207668_10135136
119 Ga0207683_10126792
120 Ga0209281_1000032
121 Ga0307515_10082890
122 Ga0265331_10040834
123 Ga0307513_10166365
124 Ga0265314_10032093
125 Ga0307405_10001547
126 Ga0307406_10051963
127 Ga0307412_10003058
128 Ga0307414_10096069
129 Ga0395900_0384437
130 Ga0395898_0124343
131 Ga0395905_0000972
132 Ga0395905_0002565
133 Ga0436364_1150303
134 Ga0436364_1471961
135 Ga0436365_0109783
136 Ga0436363_0979682
137 Ga0436362_1212516
138 Ga0439438_008454
139 Ga0439447_010663
140 Ga0495638_0029760
141 Ga0495654_0000043
142 Ga0495686_0057023
143 Ga0496106_0002048
144 Ga0496106_0077636
145 Ga0496116_0011416
146 Ga0496116_0024714
147 Ga0496116_0055189
148 Ga0496118_0119303
149 Ga0496121_0012931
150 Ga0496121_0015360
151 Ga0496122_0086039
152 Ga0496124_0007824
153 Ga0496124_0036788
154 Ga0496124_0089643
155 Ga0496126_0010537
156 Ga0501032_0010228
157 Ga0501043_0103723
158 Ga0501046_0109454
159 Ga0501047_0112457
160 Ga0501067_0144154
161 Ga0501068_0013555
162 Ga0501083_0045142
163 Ga0500618_000008
164 Ga0500618_000527
165 Ga0500568_0001485
166 Ga0500604_0000189
167 Ga0501082_0056554
168 2842369495
169 2509388208
170 2511197875
171 2512531452
172 2513635729
173 2515610726
174 2561469389
175 2585225435
176 2585548290
177 2586004327
178 2643806364
179 2644494868
180 2644495715
181 2738805302
182 2793329379
183 2819683487
184 2821130661
185 2838079854
186 2842342869
187 2857536076
188 2876770308
189 2882459333
190 2908673347
191 2913298960
192 2924762226
193 2936368289
194 2936376122
195 2957445154
196 2960619858
197 2960661819
198 2977525414
199 2996895365
200 3002141257
201 3003934291
202 3005446591
203 8001848566
204 8005376778
205 8045866939
206 8057136050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17042

NBD_C

Nucleotide-binding C-terminal domain

271

426

0.94

PF07005

SBD_N

Sugar-binding N-terminal domain

16

246

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dmh-assembly1.cif.gz_A crystal structure of a domain of unknown function (duf1537) from ralstonia eutropha h16 (h16_a1561), target efi-511666, complex with adp. 0.919 2 392
5dmh-assembly1.cif.gz_A crystal structure of a domain of unknown function (duf1537) from ralstonia eutropha h16 (h16_a1561), target efi-511666, complex with adp. 0.9122 2 392
3dqq-assembly2.cif.gz_B the crystal structure of the putative trna synthase from salmonella typhimurium lt2 0.8119 3 385
5dmh-assembly2.cif.gz_B crystal structure of a domain of unknown function (duf1537) from ralstonia eutropha h16 (h16_a1561), target efi-511666, complex with adp. 0.8031 2 392
5dmh-assembly2.cif.gz_B crystal structure of a domain of unknown function (duf1537) from ralstonia eutropha h16 (h16_a1561), target efi-511666, complex with adp. 0.7978 2 392
ID Description Score Start End Superfamily
5dmhA02 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;Four-carbon acid sugar kinase, nucleotide binding domain 0.949 214 392 3.40.980.20
5dmhA02 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;Four-carbon acid sugar kinase, nucleotide binding domain 0.9438 214 392 3.40.980.20
af_Q46889_243_386_3.40.980.20 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;Four-carbon acid sugar kinase, nucleotide binding domain 0.9111 217 351 3.40.980.20
3dqqB02 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;Four-carbon acid sugar kinase, nucleotide binding domain 0.8956 218 385 3.40.980.20
5dmhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Putative sugar-binding, N-terminal domain 0.8546 2 213 3.40.50.10840
ID Description Score Start End GO Terms
AF-A0A352RRW0-F1-model_v4 Four-carbon acid sugar kinase N-terminal domain-containing protein 0.9922 2 76
AF-A0A6A4R8Q4-F1-model_v4 Four-carbon acid sugar kinase nucleotide binding domain-containing protein 0.9787 298 391
AF-A0A833G474-F1-model_v4 Four-carbon acid sugar kinase nucleotide binding domain-containing protein 0.9735 254 391
AF-A0A847DWN9-F1-model_v4 Four-carbon acid sugar kinase nucleotide binding domain-containing protein 0.9667 279 389
AF-A0A836ZIB8-F1-model_v4 deleted 0.9613 264 391

Map