F022314

General Info

Members Datasets Scaffolds Average Seq Length
103 52 206 373

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0007924|Ga0453684_0007924_2343_3512
Length 389
Sequence MMKKIIVMIYLKNIFKNIDWMLFGSVFLIVCAGLVTMNSFIQIGQIDASSGRFFNRQVFWFAISVVVFFIASGIDWRFLRSTKIVVTTFVLSVGLLSLLFILGSVFKGAQSWFDFGALSFQPADPIKLVIILLLAKYFSRRHIEIARIRHILVSGFYVFVIFILVFLQPDFGSAIIIFFLWLGMILVSGISKKHLLLVFLVGSIAFGGLWFFVFKPYQKDRIVNFIHPLANVRGSGYNAYQSTIAVGSGQMWGKGIGYGTQSKLQFLPEYQTDFIFAAYAEEWGFVGVILLFILYGTVFWRMLSISFRGESNFEILFGTGLTILFLIHTIIHIGMNIGLLPVTGNTLPFMSYGGSHLLTEFFGLGILMGMKRYSRTVHKSIAQNEMVGV

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
19 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
20 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
21 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
22 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
23 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
24 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
25 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
26 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
27 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
28 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
29 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
30 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
31 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
32 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
33 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
34 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
35 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
36 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
37 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
38 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
39 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
40 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
41 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
42 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
43 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
44 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
45 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
46 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
47 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
48 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
49 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
50 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
51 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
52 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 0
Rhizoplane 0
Rhizosphere 96.12
Stem 0
Stem Tuber 0
Unclassified 10.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0007924 3300044712 Bacteria 19268
2 rootH2_10315332 3300003320 Bacteria 2144
3 Ga0070680_100009662 3300005336 Bacteria 7421
4 Ga0070680_100102107 3300005336 Unclassified 2381
5 Ga0070671_100003849 3300005355 Bacteria 11794
6 Ga0070701_10013304 3300005438 Unclassified 3740
7 Ga0070711_100001419 3300005439 Bacteria 13160
8 Ga0070681_10056628 3300005458 Bacteria 3901
9 Ga0070681_10203190 3300005458 Unclassified 1899
10 Ga0070679_100003182 3300005530 Bacteria 15005
11 Ga0070679_100052504 3300005530 Bacteria 4059
12 Ga0070679_100093374 3300005530 Unclassified 2997
13 Ga0070704_100000021 3300005549 Bacteria 51800
14 Ga0070704_100084589 3300005549 Bacteria 2345
15 Ga0068855_100070171 3300005563 Bacteria 4077
16 Ga0068856_100021016 3300005614 Bacteria 6343
17 Ga0068860_100000018 3300005843 Bacteria 305102
18 Ga0207707_10000098 3300025912 Bacteria 87035
19 Ga0207652_10000908 3300025921 Bacteria 27985
20 Ga0207667_10082310 3300025949 Bacteria 3334
21 Ga0207667_10228070 3300025949 Bacteria 1908
22 Ga0207702_10015506 3300026078 Bacteria 6311
23 Ga0268264_10000707 3300028381 Bacteria 38446
24 Ga0265334_10020729 3300028573 Unclassified 2690
25 Ga0265336_10000015 3300028666 Bacteria 239654
26 Ga0265336_10005355 3300028666 Bacteria 4744
27 Ga0265338_10000002 3300028800 Bacteria 856588
28 Ga0265338_10000387 3300028800 Bacteria 78855
29 Ga0265338_10000405 3300028800 Bacteria 77392
30 Ga0265338_10003479 3300028800 Bacteria 22124
31 Ga0265338_10005623 3300028800 Bacteria 16275
32 Ga0265338_10007321 3300028800 Bacteria 13764
33 Ga0265338_10007977 3300028800 Bacteria 12960
34 Ga0265338_10012400 3300028800 Bacteria 9717
35 Ga0265338_10059763 3300028800 Bacteria 3356
36 Ga0265338_10064869 3300028800 Bacteria 3172
37 Ga0265338_10067590 3300028800 Bacteria 3085
38 Ga0265338_10095045 3300028800 Bacteria 2450
39 Ga0265338_10200284 3300028800 Bacteria 1506
40 Ga0265330_10014195 3300031235 Bacteria 3698
41 Ga0265330_10033126 3300031235 Unclassified 2313
42 Ga0265330_10037406 3300031235 Unclassified 2161
43 Ga0265320_10055458 3300031240 Unclassified 1907
44 Ga0265325_10029506 3300031241 Bacteria 2948
45 Ga0265340_10000027 3300031247 Bacteria 70367
46 Ga0265327_10000509 3300031251 Bacteria 67535
47 Ga0265327_10001123 3300031251 Bacteria 36953
48 Ga0265327_10121052 3300031251 Bacteria 1240
49 Ga0265316_10019330 3300031344 Bacteria 5829
50 Ga0265316_10041638 3300031344 Bacteria 3674
51 Ga0265316_10057206 3300031344 Bacteria 3042
52 Ga0265316_10149595 3300031344 Unclassified 1749
53 Ga0265313_10010690 3300031595 Bacteria 5777
54 Ga0265313_10047667 3300031595 Bacteria 2072
55 Ga0265314_10099869 3300031711 Bacteria 1868
56 Ga0265342_10006068 3300031712 Bacteria 9066
57 Ga0395900_0145547 3300037418 Bacteria 2423
58 Ga0451577_0000039 3300042876 Bacteria 346861
59 Ga0451577_0008940 3300042876 Bacteria 9690
60 Ga0451577_0052217 3300042876 Bacteria 3650
61 Ga0453684_0000030 3300044712 Bacteria 752725
62 Ga0453684_0000112 3300044712 Bacteria 359823
63 Ga0453684_0012071 3300044712 Bacteria 14347
64 Ga0451576_0000547 3300045051 Bacteria 80650
65 Ga0451576_0001116 3300045051 Bacteria 48771
66 Ga0451576_0001904 3300045051 Bacteria 33468
67 Ga0451576_0005770 3300045051 Bacteria 15411
68 Ga0451576_0264600 3300045051 Bacteria 1797
69 Ga0501032_0027246 3300049569 Bacteria 3928
70 Ga0501034_0000343 3300049571 Bacteria 80985
71 Ga0501034_0005238 3300049571 Bacteria 14228
72 Ga0501034_0045214 3300049571 Bacteria 4450
73 Ga0501034_0094087 3300049571 Bacteria 2994
74 Ga0501034_0144684 3300049571 Bacteria 2355
75 Ga0501037_0004210 3300049573 Bacteria 10436
76 Ga0501037_0011655 3300049573 Bacteria 6472
77 Ga0501037_0012941 3300049573 Bacteria 6149
78 Ga0501037_0016452 3300049573 Bacteria 5444
79 Ga0501038_0007860 3300049574 Bacteria 9828
80 Ga0501038_0148956 3300049574 Unclassified 1909
81 Ga0501039_0003926 3300049575 Bacteria 11174
82 Ga0501039_0207487 3300049575 Bacteria 1540
83 Ga0501040_0029859 3300049576 Bacteria 3679
84 Ga0501041_0107453 3300049577 Bacteria 1730
85 Ga0501042_0034064 3300049578 Bacteria 3612
86 Ga0501043_0000025 3300049579 Bacteria 149850
87 Ga0501043_0048857 3300049579 Bacteria 3325
88 Ga0501046_0017020 3300049580 Bacteria 6078
89 Ga0501047_0001860 3300049581 Bacteria 20319
90 Ga0501047_0075754 3300049581 Bacteria 3238
91 Ga0501047_0269574 3300049581 Unclassified 1549
92 Ga0501073_0000001 3300049589 Bacteria 677932
93 Ga0501249_000196 3300049679 Bacteria 18492
94 Ga0501080_0000393 3300049742 Bacteria 33669
95 Ga0501035_0079814 3300049822 Bacteria 2890
96 Ga0501035_0118563 3300049822 Bacteria 2315
97 Ga0501035_0192880 3300049822 Bacteria 1751
98 Ga0501045_0020752 3300049824 Bacteria 4694
99 Ga0500556_0000754 3300053104 Bacteria 19312
100 Ga0500556_0018381 3300053104 Bacteria 2205
101 Ga0500616_0000174 3300053153 Bacteria 107571
102 Ga0501084_0019943 3300054114 Bacteria 5588
103 Ga0501082_0035700 3300060353 Bacteria 4284
104 Ga0453684_0007924
105 rootH2_10315332
106 Ga0070680_100009662
107 Ga0070680_100102107
108 Ga0070671_100003849
109 Ga0070701_10013304
110 Ga0070711_100001419
111 Ga0070681_10056628
112 Ga0070681_10203190
113 Ga0070679_100003182
114 Ga0070679_100052504
115 Ga0070679_100093374
116 Ga0070704_100000021
117 Ga0070704_100084589
118 Ga0068855_100070171
119 Ga0068856_100021016
120 Ga0068860_100000018
121 Ga0207707_10000098
122 Ga0207652_10000908
123 Ga0207667_10082310
124 Ga0207667_10228070
125 Ga0207702_10015506
126 Ga0268264_10000707
127 Ga0265334_10020729
128 Ga0265336_10000015
129 Ga0265336_10005355
130 Ga0265338_10000002
131 Ga0265338_10000387
132 Ga0265338_10000405
133 Ga0265338_10003479
134 Ga0265338_10005623
135 Ga0265338_10007321
136 Ga0265338_10007977
137 Ga0265338_10012400
138 Ga0265338_10059763
139 Ga0265338_10064869
140 Ga0265338_10067590
141 Ga0265338_10095045
142 Ga0265338_10200284
143 Ga0265330_10014195
144 Ga0265330_10033126
145 Ga0265330_10037406
146 Ga0265320_10055458
147 Ga0265325_10029506
148 Ga0265340_10000027
149 Ga0265327_10000509
150 Ga0265327_10001123
151 Ga0265327_10121052
152 Ga0265316_10019330
153 Ga0265316_10041638
154 Ga0265316_10057206
155 Ga0265316_10149595
156 Ga0265313_10010690
157 Ga0265313_10047667
158 Ga0265314_10099869
159 Ga0265342_10006068
160 Ga0395900_0145547
161 Ga0451577_0000039
162 Ga0451577_0008940
163 Ga0451577_0052217
164 Ga0453684_0000030
165 Ga0453684_0000112
166 Ga0453684_0012071
167 Ga0451576_0000547
168 Ga0451576_0001116
169 Ga0451576_0001904
170 Ga0451576_0005770
171 Ga0451576_0264600
172 Ga0501032_0027246
173 Ga0501034_0000343
174 Ga0501034_0005238
175 Ga0501034_0045214
176 Ga0501034_0094087
177 Ga0501034_0144684
178 Ga0501037_0004210
179 Ga0501037_0011655
180 Ga0501037_0012941
181 Ga0501037_0016452
182 Ga0501038_0007860
183 Ga0501038_0148956
184 Ga0501039_0003926
185 Ga0501039_0207487
186 Ga0501040_0029859
187 Ga0501041_0107453
188 Ga0501042_0034064
189 Ga0501043_0000025
190 Ga0501043_0048857
191 Ga0501046_0017020
192 Ga0501047_0001860
193 Ga0501047_0075754
194 Ga0501047_0269574
195 Ga0501073_0000001
196 Ga0501249_000196
197 Ga0501080_0000393
198 Ga0501035_0079814
199 Ga0501035_0118563
200 Ga0501035_0192880
201 Ga0501045_0020752
202 Ga0500556_0000754
203 Ga0500556_0018381
204 Ga0500616_0000174
205 Ga0501084_0019943
206 Ga0501082_0035700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

19

376

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.8234 33 371
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.8194 33 371
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.8069 33 371
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.8067 33 371
6pl6-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.8018 33 371
ID Description Score Start End Superfamily
af_A0A1D6LC48_865_959_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4184 92 184 1.25.10.10
af_A0A1D6LC48_865_959_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3738 92 184 1.25.10.10
af_I1L1W5_34_188_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.2927 47 174 1.20.140.40
af_Q17510_14_201_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2912 131 255 1.25.40.10
af_Q869X6_2_269_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2895 129 333 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A1F8US87-F1-model_v4 Rod shape-determining protein RodA 0.8629 41 367 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A1F5NN40-F1-model_v4 Rod shape-determining protein RodA 0.8618 28 372 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555
AF-A0A554MS92-F1-model_v4 Rod shape-determining protein RodA 0.8613 31 365 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A321LFX7-F1-model_v4 Rod shape-determining protein RodA 0.861 30 371 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A2H0UP72-F1-model_v4 Rod shape-determining protein RodA 0.8609 31 365 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301

Map