F016332

General Info

Members Datasets Scaffolds Average Seq Length
102 71 204 329

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0031688|Ga0451577_0031688_1338_2354
Length 338
Sequence MGQLAYAADMKAAFIRRTGPSDVIEFGDLPEPTPAAQQCLIRVRAVAVNPIDVYWRAGMVPAKMNFPFILGRDLAGEVIHTGPEVKRFKPGDRVWCSNQGFAGRPGSFAEFAAVDESWLHPTPTNVSDEDIVANALTGITAQLGLRKAGLQAGETLFVNGGTGGVGSCVVQMAKALGARVCTTAGNAAKVQLCRELGADLALNYRTDDVDAALRAFAPNGVHVWWETLREPDFDRTVAHLSVRGRMVLMAGRDARPSFPVGPFYVKDAALIGFAMFNASAEEQRASGEAVNHWMSTGQLRARIDRVLPLSAAAEAHRLQEQSTVQKSGELAGKIVLTV

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
16 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
17 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
18 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
19 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
20 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
21 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
29 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
30 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
31 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
32 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
33 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
34 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
35 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
36 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
37 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
38 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
39 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
40 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
41 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
42 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
43 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
44 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
45 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
46 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
47 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
48 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
49 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
50 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
51 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
52 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
53 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
54 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
55 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
56 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
57 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
58 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
59 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
60 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
61 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
62 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
63 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
64 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
65 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
69 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
70 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
71 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.98
Rhizosphere 99.02
Stem 0
Stem Tuber 0
Unclassified 8.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0031688 3300042876 Bacteria 4769
2 Ga0070670_100214981 3300005331 Bacteria 1672
3 Ga0070670_100477108 3300005331 Unclassified 1107
4 Ga0070667_100375698 3300005367 Bacteria 1290
5 Ga0070714_100020283 3300005435 Bacteria 5426
6 Ga0070714_100284936 3300005435 Bacteria 1536
7 Ga0070713_100192577 3300005436 Unclassified 1838
8 Ga0070708_100132925 3300005445 Bacteria 2304
9 Ga0070681_10195424 3300005458 Bacteria 1942
10 Ga0070685_10170915 3300005466 Archaea 1393
11 Ga0068855_100074188 3300005563 Bacteria 3952
12 Ga0068855_100101901 3300005563 Bacteria 3305
13 Ga0068855_100249411 3300005563 Bacteria 1980
14 Ga0068855_100327845 3300005563 Bacteria 1691
15 Ga0068857_100001295 3300005577 Bacteria 19638
16 Ga0068856_100265681 3300005614 Bacteria 1731
17 Ga0070717_10204949 3300006028 Bacteria 1729
18 Ga0068871_100025683 3300006358 Bacteria 4586
19 Ga0105240_10001364 3300009093 Bacteria 41940
20 Ga0105238_10070134 3300009551 Bacteria 3505
21 Ga0157374_10187018 3300013296 Unclassified 2025
22 Ga0157374_10218241 3300013296 Bacteria 1871
23 Ga0163163_10000010 3300014325 Bacteria 264773
24 Ga0163163_10080972 3300014325 Bacteria 3248
25 Ga0157376_10084908 3300014969 Unclassified 2727
26 Ga0213873_10000796 3300021358 Bacteria 5098
27 Ga0213871_10003251 3300021441 Bacteria 3109
28 Ga0207695_10012226 3300025913 Bacteria 10308
29 Ga0207660_10113635 3300025917 Bacteria 2041
30 Ga0207652_10159180 3300025921 Unclassified 2024
31 Ga0207664_10023342 3300025929 Bacteria 4633
32 Ga0207664_10275496 3300025929 Bacteria 1475
33 Ga0207667_10035875 3300025949 Bacteria 5319
34 Ga0207667_10077923 3300025949 Bacteria 3436
35 Ga0207667_10305924 3300025949 Bacteria 1624
36 Ga0207674_10109327 3300026116 Bacteria 2741
37 Ga0268266_10000699 3300028379 Bacteria 45251
38 Ga0265337_1012785 3300028556 Bacteria 2839
39 Ga0265338_10000040 3300028800 Bacteria 232041
40 Ga0265338_10000075 3300028800 Bacteria 180334
41 Ga0265338_10012306 3300028800 Bacteria 9765
42 Ga0265338_10053108 3300028800 Bacteria 3629
43 Ga0265324_10000339 3300029957 Bacteria 34323
44 Ga0265324_10006408 3300029957 Bacteria 4914
45 Ga0265340_10046037 3300031247 Bacteria 2129
46 Ga0265339_10002062 3300031249 Bacteria 14754
47 Ga0265331_10000272 3300031250 Bacteria 57459
48 Ga0265313_10000966 3300031595 Bacteria 28461
49 Ga0265314_10000828 3300031711 Bacteria 36769
50 Ga0316576_10247533 3300031727 Bacteria 1338
51 Ga0373926_0037745 3300035083 Bacteria 1719
52 Ga0316574_0040971 3300035398 Bacteria 2853
53 Ga0373935_0056566 3300035692 Bacteria 2501
54 Ga0373927_0066638 3300035695 Bacteria 2329
55 Ga0373925_0002521 3300037068 Bacteria 14618
56 Ga0436360_1358335 3300039438 Bacteria 5904
57 Ga0436361_0572996 3300039447 Bacteria 8324
58 Ga0436362_0939444 3300039453 Bacteria 7458
59 Ga0451577_0001420 3300042876 Bacteria 31947
60 Ga0451577_0015602 3300042876 Bacteria 7060
61 Ga0451577_0214371 3300042876 Bacteria 1740
62 Ga0453684_0000532 3300044712 Bacteria 145255
63 Ga0453684_0013877 3300044712 Bacteria 12997
64 Ga0453684_0027690 3300044712 Bacteria 8114
65 Ga0453684_0278943 3300044712 Bacteria 1907
66 Ga0451576_0035903 3300045051 Bacteria 5257
67 Ga0451576_0040416 3300045051 Bacteria 4937
68 Ga0451576_0062705 3300045051 Unclassified 3875
69 Ga0451576_0210647 3300045051 Unclassified 2030
70 Ga0495641_0012213 3300046461 Bacteria 4821
71 Ga0495582_0006492 3300046473 Bacteria 6491
72 Ga0495628_0043014 3300046516 Bacteria 3601
73 Ga0495630_0002767 3300046517 Bacteria 12178
74 Ga0495630_0009071 3300046517 Bacteria 7148
75 Ga0495666_0006744 3300046526 Bacteria 5775
76 Ga0495666_0007252 3300046526 Bacteria 5564
77 Ga0495665_0064717 3300046531 Bacteria 1930
78 Ga0495640_0048583 3300046533 Bacteria 2931
79 Ga0495640_0148383 3300046533 Bacteria 1508
80 Ga0495586_0000242 3300046535 Bacteria 36385
81 Ga0495586_0008513 3300046535 Bacteria 5459
82 Ga0495634_0071835 3300046642 Bacteria 2277
83 Ga0495635_0032750 3300046663 Bacteria 3605
84 Ga0495657_0035500 3300046675 Unclassified 3454
85 Ga0495658_0005970 3300046683 Bacteria 5980
86 Ga0495669_0141477 3300046684 Unclassified 1136
87 Ga0495624_0050938 3300046690 Viruses 2622
88 Ga0495624_0064981 3300046690 Bacteria 2280
89 Ga0495674_0020339 3300047319 Bacteria 6146
90 Ga0495676_0021431 3300047321 Bacteria 5643
91 Ga0495676_0057792 3300047321 Bacteria 3056
92 Ga0495684_0182880 3300047471 Bacteria 1553
93 Ga0496115_0013438 3300048918 Bacteria 6196
94 Ga0501046_0026936 3300049580 Bacteria 4694
95 Ga0501046_0033246 3300049580 Bacteria 4169
96 Ga0501047_0023668 3300049581 Bacteria 5896
97 Ga0501047_0107492 3300049581 Bacteria 2671
98 Ga0501048_0158392 3300049582 Bacteria 1602
99 Ga0501070_0000683 3300049586 Bacteria 31079
100 nmdc:mga0a205_374513_c1 3300050515 Bacteria 1289
101 Ga0495601_0166425 3300053077 Bacteria 1441
102 Ga0495619_0102207 3300053085 Bacteria 1952
103 Ga0451577_0031688
104 Ga0070670_100214981
105 Ga0070670_100477108
106 Ga0070667_100375698
107 Ga0070714_100020283
108 Ga0070714_100284936
109 Ga0070713_100192577
110 Ga0070708_100132925
111 Ga0070681_10195424
112 Ga0070685_10170915
113 Ga0068855_100074188
114 Ga0068855_100101901
115 Ga0068855_100249411
116 Ga0068855_100327845
117 Ga0068857_100001295
118 Ga0068856_100265681
119 Ga0070717_10204949
120 Ga0068871_100025683
121 Ga0105240_10001364
122 Ga0105238_10070134
123 Ga0157374_10187018
124 Ga0157374_10218241
125 Ga0163163_10000010
126 Ga0163163_10080972
127 Ga0157376_10084908
128 Ga0213873_10000796
129 Ga0213871_10003251
130 Ga0207695_10012226
131 Ga0207660_10113635
132 Ga0207652_10159180
133 Ga0207664_10023342
134 Ga0207664_10275496
135 Ga0207667_10035875
136 Ga0207667_10077923
137 Ga0207667_10305924
138 Ga0207674_10109327
139 Ga0268266_10000699
140 Ga0265337_1012785
141 Ga0265338_10000040
142 Ga0265338_10000075
143 Ga0265338_10012306
144 Ga0265338_10053108
145 Ga0265324_10000339
146 Ga0265324_10006408
147 Ga0265340_10046037
148 Ga0265339_10002062
149 Ga0265331_10000272
150 Ga0265313_10000966
151 Ga0265314_10000828
152 Ga0316576_10247533
153 Ga0373926_0037745
154 Ga0316574_0040971
155 Ga0373935_0056566
156 Ga0373927_0066638
157 Ga0373925_0002521
158 Ga0436360_1358335
159 Ga0436361_0572996
160 Ga0436362_0939444
161 Ga0451577_0001420
162 Ga0451577_0015602
163 Ga0451577_0214371
164 Ga0453684_0000532
165 Ga0453684_0013877
166 Ga0453684_0027690
167 Ga0453684_0278943
168 Ga0451576_0035903
169 Ga0451576_0040416
170 Ga0451576_0062705
171 Ga0451576_0210647
172 Ga0495641_0012213
173 Ga0495582_0006492
174 Ga0495628_0043014
175 Ga0495630_0002767
176 Ga0495630_0009071
177 Ga0495666_0006744
178 Ga0495666_0007252
179 Ga0495665_0064717
180 Ga0495640_0048583
181 Ga0495640_0148383
182 Ga0495586_0000242
183 Ga0495586_0008513
184 Ga0495634_0071835
185 Ga0495635_0032750
186 Ga0495657_0035500
187 Ga0495658_0005970
188 Ga0495669_0141477
189 Ga0495624_0050938
190 Ga0495624_0064981
191 Ga0495674_0020339
192 Ga0495676_0021431
193 Ga0495676_0057792
194 Ga0495684_0182880
195 Ga0496115_0013438
196 Ga0501046_0026936
197 Ga0501046_0033246
198 Ga0501047_0023668
199 Ga0501047_0107492
200 Ga0501048_0158392
201 Ga0501070_0000683
202 nmdc:mga0a205_374513_c1
203 Ga0495601_0166425
204 Ga0495619_0102207

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

164

291

0.92

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

35

124

0.9

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

196

336

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b7x-assembly5.cif.gz_I crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.8439 107 311
6isv-assembly1.cif.gz_B structure of acetophenone reductase from geotrichum candidum nbrc 4597 in complex with nad 0.8318 92 312
3i4c-assembly1.cif.gz_D crystal structure of sulfolobus solfataricus adh(ssadh) double mutant (w95l,n249y) 0.8254 49 296
1pqw-assembly1.cif.gz_B putative enoyl reductase domain of polyketide synthase 0.8243 110 274
3i4c-assembly1.cif.gz_B crystal structure of sulfolobus solfataricus adh(ssadh) double mutant (w95l,n249y) 0.8207 49 290
ID Description Score Start End Superfamily
af_Q08257_129_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9134 110 275 3.40.50.720
af_Q869N3_132_238_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9096 109 211 3.90.180.10
2eihB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.909 110 247 3.40.50.720
af_O45496_127_286_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9074 110 265 3.40.50.720
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9045 111 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Y2SFH1-F1-model_v4 Type I polyketide synthase WcbR 0.9793 110 193 GO:0016651
GO:0070402
AF-A0A7Y2PJZ3-F1-model_v4 Zinc-binding dehydrogenase 0.9396 94 221 GO:0016651
GO:0070402
AF-A0A659UHD6-F1-model_v4 Quinone oxidoreductase 0.9344 86 180 GO:0003960
GO:0005829
GO:0008270
GO:0035925
GO:0070402
AF-A0A0A9DC99-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9292 110 209 GO:0003960
GO:0005829
GO:0035925
GO:0070402
AF-A0A1S8G4K1-F1-model_v4 deleted 0.9065 42 177

Map