F013724

General Info

Members Datasets Scaffolds Average Seq Length
102 81 204 254

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100066857|Ga0070686_1000668572
Length 262
Sequence MTSESANLPAAVDRAAFQAELDALRVREKAHTREGDAIAAARRRLPMVEVDASQELTGPDGPVTLLDAFEGRRQLIAYYFMWWPGHPAADQCEGCTWVTTQVRELSYLHSRDITFAVFCQGRNVTYDTPPAHPYDESVRYRDFMGWDMPWYSAHASLDTLLAGREIGLFHLVCYLRDGDRVFETYWTTRRGAEAMDNNYALMDLTVYGRQEPWEDSPSGWPRGFGDHTRINGRPIAQWPRIEAGRSDDLTLPQTLYPQEAAT

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
5 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
6 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
10 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
27 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
37 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
38 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
39 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
40 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
41 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
42 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
43 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
44 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
45 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
46 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
47 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
48 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
49 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
50 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
51 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
52 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
53 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
54 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
55 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
56 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
57 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
58 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
59 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
60 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
61 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
63 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
64 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
65 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
66 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
67 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
68 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
69 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
70 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
71 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
72 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
73 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
74 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
75 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
76 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
77 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
78 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
79 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
80 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
81 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.08
Metatranscriptomes 0.98
Isolates 2.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.73
Nodule 0
Rhizoplane 1.96
Rhizosphere 73.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100066857 3300005544 Bacteria 2340
2 Ga0070667_100375221 3300005367 Bacteria 1291
3 Ga0070713_100137924 3300005436 Bacteria 2157
4 Ga0070706_100077836 3300005467 Bacteria 3070
5 Ga0070698_100084625 3300005471 Bacteria 3159
6 Ga0070699_100002660 3300005518 Bacteria 15959
7 Ga0070679_100072152 3300005530 Bacteria 3444
8 Ga0070697_100001221 3300005536 Bacteria 19396
9 Ga0068864_100216846 3300005618 Bacteria 1764
10 Ga0068860_100375656 3300005843 Bacteria 1402
11 Ga0081455_10006337 3300005937 Bacteria 12706
12 Ga0081538_10002457 3300005981 Bacteria 18112
13 Ga0081538_10015714 3300005981 Bacteria 5843
14 Ga0075364_10172411 3300006051 Bacteria 1462
15 Ga0075367_10152632 3300006178 Bacteria 1434
16 Ga0075428_100006741 3300006844 Bacteria 12775
17 Ga0075428_100149336 3300006844 Bacteria 2539
18 Ga0075430_100101511 3300006846 Bacteria 2402
19 Ga0075430_100327106 3300006846 Bacteria 1267
20 Ga0075431_100004493 3300006847 Bacteria 13688
21 Ga0075431_100331099 3300006847 Bacteria 1533
22 Ga0075429_100008032 3300006880 Bacteria 9170
23 Ga0099794_10142174 3300007265 Bacteria 1216
24 Ga0105250_10058976 3300009092 Bacteria 1541
25 Ga0111539_10207335 3300009094 Bacteria 2284
26 Ga0114129_10048040 3300009147 Bacteria 5996
27 Ga0114129_10257284 3300009147 Bacteria 2341
28 Ga0157339_1003507 3300012505 Bacteria 1138
29 Ga0163162_10189766 3300013306 Bacteria 2182
30 Ga0163163_10046505 3300014325 Bacteria 4263
31 Ga0213875_10000231 3300021388 Bacteria 56495
32 Ga0209676_1000138 3300025292 Bacteria 178932
33 Ga0209050_1003999 3300025298 Bacteria 10392
34 Ga0207688_10371357 3300025901 Bacteria 884
35 Ga0207684_10021293 3300025910 Bacteria 5536
36 Ga0207684_10256217 3300025910 Bacteria 1510
37 Ga0207707_10014309 3300025912 Bacteria 6910
38 Ga0207646_10008057 3300025922 Bacteria 10621
39 Ga0207646_10015244 3300025922 Bacteria 7271
40 Ga0207646_10489675 3300025922 Bacteria 1108
41 Ga0207700_10385449 3300025928 Bacteria 1226
42 Ga0207658_10307933 3300025986 Bacteria 1367
43 Ga0265762_1000186 3300030760 Bacteria 9795
44 Ga0307408_100042283 3300031548 Bacteria 3236
45 Ga0307408_100551426 3300031548 Bacteria 1017
46 Ga0307416_100026662 3300032002 Bacteria 4262
47 Ga0307416_100175559 3300032002 Bacteria 2001
48 Ga0307416_100223372 3300032002 Bacteria 1809
49 Ga0307414_10438505 3300032004 Bacteria 1143
50 Ga0307415_100036448 3300032126 Bacteria 3223
51 Ga0395898_0636820 3300037466 Bacteria 1009
52 Ga0436364_0118735 3300037853 Bacteria 19655
53 Ga0436364_0128379 3300037853 Bacteria 1938
54 Ga0436364_0717007 3300037853 Bacteria 89692
55 Ga0436365_1727965 3300039437 Bacteria 960
56 Ga0439460_0112464 3300042461 Bacteria 885
57 Ga0466972_0111725 3300044658 Bacteria 1291
58 Ga0466965_0223068 3300044683 Bacteria 1005
59 Ga0466963_0009134 3300044694 Bacteria 5962
60 Ga0466963_0266064 3300044694 Bacteria 1204
61 Ga0466964_0028075 3300044706 Bacteria 2214
62 Ga0466958_0266433 3300045836 Bacteria 1097
63 Ga0466967_0014050 3300045976 Bacteria 6219
64 Ga0466967_0038413 3300045976 Bacteria 4106
65 Ga0466967_0150924 3300045976 Bacteria 2172
66 Ga0495582_0109870 3300046473 Bacteria 1548
67 Ga0495663_0049254 3300046525 Bacteria 1301
68 Ga0495665_0006029 3300046531 Bacteria 6531
69 Ga0495581_0211408 3300047315 Bacteria 1134
70 Ga0495672_0133227 3300047320 Bacteria 1305
71 Ga0495593_0167460 3300047673 Bacteria 1108
72 Ga0496102_0000007 3300048905 Bacteria 417224
73 Ga0496103_0000071 3300048906 Bacteria 119931
74 Ga0496116_0000033 3300048919 Bacteria 418191
75 Ga0496117_0000025 3300048920 Bacteria 418106
76 Ga0496118_0000023 3300048921 Bacteria 418106
77 Ga0501042_0136937 3300049578 Bacteria 1765
78 Ga0501071_0387893 3300049587 Bacteria 1066
79 Ga0501045_0121484 3300049824 Bacteria 1940
80 nmdc:mga03683_156711_c1 3300050489 Bacteria 1030
81 nmdc:mga00v17_123904_c1 3300050491 Bacteria 1648
82 nmdc:mga06z11_223775_c1 3300050494 Bacteria 1100
83 nmdc:mga05p37_1884_c1 3300050507 Bacteria 24457
84 nmdc:mga05p37_318678_c1 3300050507 Bacteria 1841
85 nmdc:mga05p37_563733_c1 3300050507 Bacteria 1293
86 nmdc:mga09592_10634_c1 3300050508 Bacteria 7495
87 nmdc:mga0qj67_298090_c1 3300050509 Bacteria 1306
88 nmdc:mga0qj67_341209_c1 3300050509 Bacteria 1212
89 nmdc:mga06r32_330747_c1 3300050510 Bacteria 1509
90 nmdc:mga06r32_485195_c1 3300050510 Bacteria 1214
91 nmdc:mga08y16_438742_c1 3300050511 Bacteria 1333
92 nmdc:mga08y16_49070_c1 3300050511 Bacteria 4417
93 Ga0500610_0108534 3300053079 Bacteria 1429
94 Ga0500583_0005058 3300053092 Bacteria 4376
95 Ga0500641_0018848 3300053096 Bacteria 2601
96 Ga0500562_001139 3300053108 Bacteria 6538
97 Ga0500652_059875 3300053131 Bacteria 1567
98 Ga0500658_0005465 3300053134 Bacteria 4726
99 Ga0500616_0097115 3300053153 Bacteria 1447
100 2868092594 2868088558 Bacteria 7609351
101 2870787666 2870782633 Bacteria 9624083
102 2929215998 2929212328 Bacteria 7708288
103 Ga0070686_100066857
104 Ga0070667_100375221
105 Ga0070713_100137924
106 Ga0070706_100077836
107 Ga0070698_100084625
108 Ga0070699_100002660
109 Ga0070679_100072152
110 Ga0070697_100001221
111 Ga0068864_100216846
112 Ga0068860_100375656
113 Ga0081455_10006337
114 Ga0081538_10002457
115 Ga0081538_10015714
116 Ga0075364_10172411
117 Ga0075367_10152632
118 Ga0075428_100006741
119 Ga0075428_100149336
120 Ga0075430_100101511
121 Ga0075430_100327106
122 Ga0075431_100004493
123 Ga0075431_100331099
124 Ga0075429_100008032
125 Ga0099794_10142174
126 Ga0105250_10058976
127 Ga0111539_10207335
128 Ga0114129_10048040
129 Ga0114129_10257284
130 Ga0157339_1003507
131 Ga0163162_10189766
132 Ga0163163_10046505
133 Ga0213875_10000231
134 Ga0209676_1000138
135 Ga0209050_1003999
136 Ga0207688_10371357
137 Ga0207684_10021293
138 Ga0207684_10256217
139 Ga0207707_10014309
140 Ga0207646_10008057
141 Ga0207646_10015244
142 Ga0207646_10489675
143 Ga0207700_10385449
144 Ga0207658_10307933
145 Ga0265762_1000186
146 Ga0307408_100042283
147 Ga0307408_100551426
148 Ga0307416_100026662
149 Ga0307416_100175559
150 Ga0307416_100223372
151 Ga0307414_10438505
152 Ga0307415_100036448
153 Ga0395898_0636820
154 Ga0436364_0118735
155 Ga0436364_0128379
156 Ga0436364_0717007
157 Ga0436365_1727965
158 Ga0439460_0112464
159 Ga0466972_0111725
160 Ga0466965_0223068
161 Ga0466963_0009134
162 Ga0466963_0266064
163 Ga0466964_0028075
164 Ga0466958_0266433
165 Ga0466967_0014050
166 Ga0466967_0038413
167 Ga0466967_0150924
168 Ga0495582_0109870
169 Ga0495663_0049254
170 Ga0495665_0006029
171 Ga0495581_0211408
172 Ga0495672_0133227
173 Ga0495593_0167460
174 Ga0496102_0000007
175 Ga0496103_0000071
176 Ga0496116_0000033
177 Ga0496117_0000025
178 Ga0496118_0000023
179 Ga0501042_0136937
180 Ga0501071_0387893
181 Ga0501045_0121484
182 nmdc:mga03683_156711_c1
183 nmdc:mga00v17_123904_c1
184 nmdc:mga06z11_223775_c1
185 nmdc:mga05p37_1884_c1
186 nmdc:mga05p37_318678_c1
187 nmdc:mga05p37_563733_c1
188 nmdc:mga09592_10634_c1
189 nmdc:mga0qj67_298090_c1
190 nmdc:mga0qj67_341209_c1
191 nmdc:mga06r32_330747_c1
192 nmdc:mga06r32_485195_c1
193 nmdc:mga08y16_438742_c1
194 nmdc:mga08y16_49070_c1
195 Ga0500610_0108534
196 Ga0500583_0005058
197 Ga0500641_0018848
198 Ga0500562_001139
199 Ga0500652_059875
200 Ga0500658_0005465
201 Ga0500616_0097115
202 2868092594
203 2870787666
204 2929215998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

6

226

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1b-assembly2.cif.gz_B resa e80q 0.7225 65 204
2h19-assembly2.cif.gz_B crystal structure of resa cys77ala variant 0.7189 65 204
3c73-assembly1.cif.gz_A structure of cehc variant resa 0.7167 60 204
3c73-assembly1.cif.gz_A structure of cehc variant resa 0.6994 60 204
2h1a-assembly1.cif.gz_A resa c74a variant 0.6976 65 195
ID Description Score Start End Superfamily
af_P54675_890_1043_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.8282 167 188 2.60.40.150
af_P9WLI7_63_230_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.747 164 188 2.40.10.10
af_Q9D1A0_27_140_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7378 62 164 3.40.30.10
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7158 59 188 3.40.30.10
af_O94561_50_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7142 60 183 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2S9FP09-F1-model_v4 DUF899 domain-containing protein 0.9155 66 182
AF-A0A2S9FP09-F1-model_v4 DUF899 domain-containing protein 0.9007 66 182
AF-A0A285D5E7-F1-model_v4 Uncharacterized protein DUF899 0.8692 59 188
AF-A0A7V8YKR5-F1-model_v4 DUF899 family protein 0.8548 58 186
AF-A0A7X0LA51-F1-model_v4 Putative dithiol-disulfide oxidoreductase (DUF899 family) 0.8507 63 214 GO:0016810

Map