F007935

General Info

Members Datasets Scaffolds Average Seq Length
101 69 202 95

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100007338|Ga0068855_1000073389
Length 95
Sequence MNKETQAVANDLGTLAQDAHALMTATADVAGEKVGEARKRLAVALERAKEMAATVREKAVAGAKVADQAVHEHPYQAIALIGFLVARRCSSRNCD

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
17 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
39 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
40 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
47 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
48 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
49 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
55 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
56 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
59 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
60 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
65 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
66 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
67 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
68 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
69 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 2.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.98
Rhizosphere 95.05
Stem 0
Stem Tuber 0
Unclassified 43.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100007338 3300005563 Bacteria 13359
2 Ga0058860_10786275 3300004801 Bacteria 680
3 Ga0070690_100681147 3300005330 Bacteria 788
4 Ga0070690_101754463 3300005330 Unclassified 505
5 Ga0070689_100293445 3300005340 Bacteria 1352
6 Ga0070709_10162956 3300005434 Unclassified 1552
7 Ga0070681_11371809 3300005458 Unclassified 630
8 Ga0070698_101592884 3300005471 Bacteria 605
9 Ga0070699_102021863 3300005518 Bacteria 527
10 Ga0070697_101166281 3300005536 Bacteria 686
11 Ga0068855_100066649 3300005563 Bacteria 4197
12 Ga0068856_100000058 3300005614 Bacteria 101767
13 Ga0068856_100366019 3300005614 Unclassified 1460
14 Ga0070702_100878999 3300005615 Bacteria 700
15 Ga0068852_100939373 3300005616 Unclassified 883
16 Ga0068859_100183630 3300005617 Unclassified 2175
17 Ga0068864_101900168 3300005618 Unclassified 601
18 Ga0068863_100013998 3300005841 Bacteria 7730
19 Ga0068863_100346813 3300005841 Unclassified 1445
20 Ga0068863_100731938 3300005841 Unclassified 984
21 Ga0070716_101081949 3300006173 Bacteria 638
22 Ga0097621_100094250 3300006237 Unclassified 2510
23 Ga0068871_100073512 3300006358 Unclassified 2818
24 Ga0075431_101083585 3300006847 Bacteria 766
25 Ga0075431_101381263 3300006847 Bacteria 664
26 Ga0075429_101181900 3300006880 Bacteria 668
27 Ga0097620_100183622 3300006931 Unclassified 2175
28 Ga0097620_100505038 3300006931 Bacteria 1304
29 Ga0097620_100955596 3300006931 Bacteria 940
30 Ga0105240_10084925 3300009093 Bacteria 3880
31 Ga0111539_12161908 3300009094 Unclassified 646
32 Ga0105237_11552404 3300009545 Unclassified 669
33 Ga0105249_13233724 3300009553 Unclassified 524
34 Ga0157371_10727221 3300013102 Unclassified 744
35 Ga0157370_10265612 3300013104 Unclassified 1585
36 Ga0157372_10049506 3300013307 Unclassified 4672
37 Ga0206351_10883646 3300020077 Bacteria 1057
38 Ga0207699_10333822 3300025906 Bacteria 1066
39 Ga0207654_10895363 3300025911 Unclassified 643
40 Ga0207652_10508232 3300025921 Unclassified 1084
41 Ga0207686_10074884 3300025934 Unclassified 2189
42 Ga0207667_10023921 3300025949 Bacteria 6720
43 Ga0207702_10000889 3300026078 Bacteria 30993
44 Ga0207702_10499129 3300026078 Bacteria 1186
45 Ga0207702_11270950 3300026078 Bacteria 730
46 Ga0207641_10036456 3300026088 Bacteria 4105
47 Ga0207641_10153429 3300026088 Unclassified 2088
48 Ga0207641_10614963 3300026088 Unclassified 1065
49 Ga0207698_10509129 3300026142 Unclassified 1173
50 Ga0265326_10055931 3300028558 Bacteria 1116
51 Ga0265319_1003708 3300028563 Bacteria 7854
52 Ga0265319_1245516 3300028563 Bacteria 546
53 Ga0265334_10088695 3300028573 Unclassified 1131
54 Ga0265323_10112900 3300028653 Bacteria 890
55 Ga0265336_10076500 3300028666 Bacteria 1000
56 Ga0265338_10003109 3300028800 Bacteria 23752
57 Ga0265338_10047875 3300028800 Bacteria 3898
58 Ga0265338_10169723 3300028800 Unclassified 1675
59 Ga0265338_10365103 3300028800 Bacteria 1035
60 Ga0265338_10799054 3300028800 Unclassified 646
61 Ga0265324_10001245 3300029957 Bacteria 15052
62 Ga0265776_101937 3300030880 Unclassified 922
63 Ga0265330_10521531 3300031235 Unclassified 506
64 Ga0265320_10106375 3300031240 Bacteria 1288
65 Ga0265325_10051462 3300031241 Unclassified 2117
66 Ga0265339_10495386 3300031249 Unclassified 564
67 Ga0265327_10050334 3300031251 Unclassified 2180
68 Ga0265327_10529268 3300031251 Unclassified 507
69 Ga0265316_10053546 3300031344 Unclassified 3161
70 Ga0265316_10165883 3300031344 Bacteria 1650
71 Ga0265316_10282222 3300031344 Bacteria 1213
72 Ga0265316_10789365 3300031344 Unclassified 666
73 Ga0265313_10314114 3300031595 Unclassified 627
74 Ga0307510_10273735 3300033180 Unclassified 1163
75 Ga0373935_1300981 3300035692 Bacteria 543
76 Ga0373927_1115410 3300035695 Bacteria 520
77 Ga0373933_0695797 3300035724 Bacteria 668
78 Ga0373937_0272699 3300036401 Bacteria 1597
79 Ga0451798_0146074 3300041458 Unclassified 682
80 Ga0451807_0661943 3300041486 Unclassified 835
81 Ga0451851_0843006 3300041507 Bacteria 1436
82 Ga0451577_0002504 3300042876 Bacteria 21787
83 Ga0451577_0011013 3300042876 Bacteria 8589
84 Ga0451577_0182266 3300042876 Unclassified 1893
85 Ga0451577_0253339 3300042876 Bacteria 1593
86 Ga0453684_0006255 3300044712 Bacteria 22805
87 Ga0453684_0012021 3300044712 Bacteria 14392
88 Ga0453684_0880718 3300044712 Bacteria 960
89 Ga0453684_1340696 3300044712 Bacteria 745
90 Ga0453684_1893100 3300044712 Bacteria 604
91 Ga0451576_0054005 3300045051 Bacteria 4207
92 Ga0451576_0309827 3300045051 Bacteria 1652
93 Ga0451576_0523382 3300045051 Bacteria 1246
94 Ga0451576_0849130 3300045051 Bacteria 958
95 Ga0451576_2682039 3300045051 Unclassified 507
96 Ga0495592_0908617 3300046454 Unclassified 517
97 Ga0495662_0604239 3300046476 Bacteria 536
98 Ga0495664_0283310 3300046477 Bacteria 1001
99 Ga0495599_0355278 3300046678 Unclassified 878
100 Ga0495682_0113451 3300049460 Unclassified 971
101 nmdc:mga06r32_927680_c1 3300050510 Bacteria 826
102 Ga0068855_100007338
103 Ga0058860_10786275
104 Ga0070690_100681147
105 Ga0070690_101754463
106 Ga0070689_100293445
107 Ga0070709_10162956
108 Ga0070681_11371809
109 Ga0070698_101592884
110 Ga0070699_102021863
111 Ga0070697_101166281
112 Ga0068855_100066649
113 Ga0068856_100000058
114 Ga0068856_100366019
115 Ga0070702_100878999
116 Ga0068852_100939373
117 Ga0068859_100183630
118 Ga0068864_101900168
119 Ga0068863_100013998
120 Ga0068863_100346813
121 Ga0068863_100731938
122 Ga0070716_101081949
123 Ga0097621_100094250
124 Ga0068871_100073512
125 Ga0075431_101083585
126 Ga0075431_101381263
127 Ga0075429_101181900
128 Ga0097620_100183622
129 Ga0097620_100505038
130 Ga0097620_100955596
131 Ga0105240_10084925
132 Ga0111539_12161908
133 Ga0105237_11552404
134 Ga0105249_13233724
135 Ga0157371_10727221
136 Ga0157370_10265612
137 Ga0157372_10049506
138 Ga0206351_10883646
139 Ga0207699_10333822
140 Ga0207654_10895363
141 Ga0207652_10508232
142 Ga0207686_10074884
143 Ga0207667_10023921
144 Ga0207702_10000889
145 Ga0207702_10499129
146 Ga0207702_11270950
147 Ga0207641_10036456
148 Ga0207641_10153429
149 Ga0207641_10614963
150 Ga0207698_10509129
151 Ga0265326_10055931
152 Ga0265319_1003708
153 Ga0265319_1245516
154 Ga0265334_10088695
155 Ga0265323_10112900
156 Ga0265336_10076500
157 Ga0265338_10003109
158 Ga0265338_10047875
159 Ga0265338_10169723
160 Ga0265338_10365103
161 Ga0265338_10799054
162 Ga0265324_10001245
163 Ga0265776_101937
164 Ga0265330_10521531
165 Ga0265320_10106375
166 Ga0265325_10051462
167 Ga0265339_10495386
168 Ga0265327_10050334
169 Ga0265327_10529268
170 Ga0265316_10053546
171 Ga0265316_10165883
172 Ga0265316_10282222
173 Ga0265316_10789365
174 Ga0265313_10314114
175 Ga0307510_10273735
176 Ga0373935_1300981
177 Ga0373927_1115410
178 Ga0373933_0695797
179 Ga0373937_0272699
180 Ga0451798_0146074
181 Ga0451807_0661943
182 Ga0451851_0843006
183 Ga0451577_0002504
184 Ga0451577_0011013
185 Ga0451577_0182266
186 Ga0451577_0253339
187 Ga0453684_0006255
188 Ga0453684_0012021
189 Ga0453684_0880718
190 Ga0453684_1340696
191 Ga0453684_1893100
192 Ga0451576_0054005
193 Ga0451576_0309827
194 Ga0451576_0523382
195 Ga0451576_0849130
196 Ga0451576_2682039
197 Ga0495592_0908617
198 Ga0495662_0604239
199 Ga0495664_0283310
200 Ga0495599_0355278
201 Ga0495682_0113451
202 nmdc:mga06r32_927680_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05957

DUF883

DUF883 N-terminal domain

6

58

0.92

Map