F005149

General Info

Members Datasets Scaffolds Average Seq Length
100 89 100 282

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000015|Ga0496104_0000015_145636_146583
Length 315
Sequence MDMASEVIGGHGRVGVNYRPHVPRRAAVCSGMQRQDLDFNVNGDACAAWFYPAAASGPSPIVVMAHGLSGTRRDGLGPFAERFAAAGIAALLFDHRGFGDSDGAPDRFEPRRQLEDWGAAIETARALPGIDAGRVATFGSSMGGGNALAAAVADPAVAAVVSQVPFLDIWTQAHRSGPGVGARMLAATVRGRHLPAVGQPHESAFINAPDAEAGWRHVVAIGEDSRWRNRVSSRWLLGRPFRPGRLAARLHCPWLVCVGEADRVARPGPAIAAARRAPRSELHTYPGVDHFDIYDGPEFEAVVADEIEFLTRHLL

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
9 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
10 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
21 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
22 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
25 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
39 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
40 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
43 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
44 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
45 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
46 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
49 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
50 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
51 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
52 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
53 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
54 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
55 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
56 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
57 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
58 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
59 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
60 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
61 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
62 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
63 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
64 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
65 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
66 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
67 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
68 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
69 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
70 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
71 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
72 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
73 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
74 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
75 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
76 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
79 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
83 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
84 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
85 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
86 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
87 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
88 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
89 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3
Nodule 0
Rhizoplane 14
Rhizosphere 81
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100052069 3300005329 Bacteria 3792
2 Ga0070666_10029084 3300005335 Bacteria 3631
3 Ga0070691_10000002 3300005341 Bacteria 90686
4 Ga0070691_10003169 3300005341 Bacteria 7364
5 Ga0070674_100000299 3300005356 Bacteria 24346
6 Ga0070667_100219033 3300005367 Bacteria 1694
7 Ga0068867_100005476 3300005459 Bacteria 8983
8 Ga0070707_100074431 3300005468 Bacteria 3275
9 Ga0070702_100265292 3300005615 Unclassified 1171
10 Ga0068864_100000090 3300005618 Bacteria 96213
11 Ga0068866_10001920 3300005718 Bacteria 8683
12 Ga0068866_10015274 3300005718 Bacteria 3408
13 Ga0068861_100144083 3300005719 Bacteria 1948
14 Ga0068858_100000065 3300005842 Bacteria 108233
15 Ga0081540_1000006 3300005983 Bacteria 208724
16 Ga0070716_100134807 3300006173 Bacteria 1566
17 Ga0075428_100508241 3300006844 Bacteria 1289
18 Ga0105247_10001118 3300009101 Bacteria 19991
19 Ga0105242_10000059 3300009176 Bacteria 75563
20 Ga0105249_10165574 3300009553 Bacteria 2140
21 Ga0105246_10044904 3300011119 Bacteria 3006
22 Ga0157370_10004542 3300013104 Bacteria 15899
23 Ga0157374_10005364 3300013296 Bacteria 10771
24 Ga0157378_10043543 3300013297 Bacteria 3986
25 Ga0157375_10000668 3300013308 Bacteria 30338
26 Ga0163161_10057205 3300017792 Bacteria 2833
27 Ga0207642_10001031 3300025899 Bacteria 8670
28 Ga0207642_10014387 3300025899 Bacteria 2919
29 Ga0207710_10000451 3300025900 Bacteria 26569
30 Ga0207680_10004019 3300025903 Bacteria 6949
31 Ga0207705_10023847 3300025909 Unclassified 4366
32 Ga0207686_10000116 3300025934 Bacteria 64638
33 Ga0207669_10000257 3300025937 Bacteria 24346
34 Ga0207665_10056277 3300025939 Bacteria 2654
35 Ga0207661_10003275 3300025944 Bacteria 11234
36 Ga0207703_10000018 3300026035 Bacteria 271377
37 Ga0207648_10010079 3300026089 Bacteria 8985
38 Ga0207676_10000016 3300026095 Bacteria 311561
39 Ga0207675_100158829 3300026118 Bacteria 2155
40 Ga0265337_1019562 3300028556 Bacteria 2131
41 Ga0265326_10023010 3300028558 Bacteria 1782
42 Ga0265319_1000014 3300028563 Bacteria 177623
43 Ga0265319_1000875 3300028563 Bacteria 19169
44 Ga0265336_10000153 3300028666 Bacteria 49150
45 Ga0265338_10000244 3300028800 Bacteria 100528
46 Ga0265338_10000935 3300028800 Bacteria 49248
47 Ga0265324_10011511 3300029957 Bacteria 3368
48 Ga0265325_10034176 3300031241 Bacteria 2707
49 Ga0265340_10000066 3300031247 Bacteria 49153
50 Ga0265339_10054430 3300031249 Bacteria 2173
51 Ga0265331_10032062 3300031250 Bacteria 2606
52 Ga0265316_10060031 3300031344 Bacteria 2956
53 Ga0495603_0001505 3300046455 Bacteria 13589
54 Ga0495629_0001620 3300046459 Bacteria 17689
55 Ga0495629_0013238 3300046459 Bacteria 5956
56 Ga0495641_0014932 3300046461 Bacteria 4181
57 Ga0495650_0000012 3300046471 Bacteria 613144
58 Ga0495662_0000051 3300046476 Bacteria 40340
59 Ga0495594_0000032 3300046499 Bacteria 63783
60 Ga0495608_0009930 3300046511 Bacteria 6646
61 Ga0495628_0010925 3300046516 Bacteria 7690
62 Ga0495628_0120551 3300046516 Bacteria 2013
63 Ga0495630_0000020 3300046517 Bacteria 176389
64 Ga0495630_0136585 3300046517 Bacteria 1863
65 Ga0495630_0371919 3300046517 Bacteria 1094
66 Ga0495652_0000010 3300046529 Bacteria 261584
67 Ga0495640_0004202 3300046533 Bacteria 11520
68 Ga0495622_0000014 3300046557 Bacteria 182142
69 Ga0495668_0038566 3300046616 Bacteria 2669
70 Ga0495634_0002178 3300046642 Bacteria 16467
71 Ga0495647_0001340 3300046681 Bacteria 7584
72 Ga0495647_0003737 3300046681 Bacteria 4890
73 Ga0495613_0018610 3300046689 Bacteria 5179
74 Ga0495670_0021967 3300046691 Bacteria 3150
75 Ga0495674_0000010 3300047319 Bacteria 285794
76 Ga0495676_0000186 3300047321 Bacteria 49054
77 Ga0495680_0016128 3300047322 Bacteria 6424
78 Ga0496100_0000001 3300048903 Bacteria 530179
79 Ga0496101_0000004 3300048904 Bacteria 331599
80 Ga0496102_0000294 3300048905 Bacteria 64001
81 Ga0496103_0000159 3300048906 Bacteria 71148
82 Ga0496104_0000015 3300048907 Bacteria 374530
83 Ga0496105_0000004 3300048908 Bacteria 475798
84 Ga0496106_0000056 3300048909 Bacteria 90682
85 Ga0496107_0000005 3300048910 Bacteria 281747
86 Ga0496108_0149279 3300048911 Bacteria 2016
87 Ga0496110_0010673 3300048913 Bacteria 7480
88 Ga0496111_0218280 3300048914 Bacteria 1416
89 Ga0496113_0018687 3300048916 Bacteria 4832
90 Ga0496114_0119226 3300048917 Bacteria 2268
91 Ga0496115_0000011 3300048918 Bacteria 222529
92 Ga0496119_0009550 3300048922 Bacteria 8303
93 Ga0496119_0051987 3300048922 Bacteria 2513
94 Ga0501042_0052635 3300049578 Bacteria 2904
95 Ga0495601_0028216 3300053077 Bacteria 3475
96 Ga0495655_0000002 3300053083 Bacteria 312752
97 Ga0495619_0000025 3300053085 Bacteria 167905
98 Ga0500566_0056198 3300053094 Bacteria 2239
99 Ga0500650_0111781 3300053098 Bacteria 1275
100 Ga0500628_000001 3300053129 Bacteria 564074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100005476 Ga0068867_1000054766 236
2 3300026089 Ga0207648_10010079 Ga0207648_100100796 236
3 3300053098 Ga0500650_0111781 Ga0500650_0111781_444_1205 239
4 3300046459 Ga0495629_0013238 Ga0495629_0013238_4224_5087 254
5 3300048917 Ga0496114_0119226 Ga0496114_0119226_1240_2022 254
6 3300053094 Ga0500566_0056198 Ga0500566_0056198_532_1395 254
7 3300005341 Ga0070691_10000002 Ga0070691_1000000241 264
8 3300046689 Ga0495613_0018610 Ga0495613_0018610_1930_2793 264
9 3300005356 Ga0070674_100000299 Ga0070674_10000029911 265
10 3300005718 Ga0068866_10001920 Ga0068866_1000192010 265
11 3300013308 Ga0157375_10000668 Ga0157375_1000066810 265
12 3300025899 Ga0207642_10001031 Ga0207642_1000103110 265
13 3300025937 Ga0207669_10000257 Ga0207669_1000025720 265
14 3300046516 Ga0495628_0120551 Ga0495628_0120551_405_1268 265
15 3300046517 Ga0495630_0371919 Ga0495630_0371919_197_1066 265
16 3300046616 Ga0495668_0038566 Ga0495668_0038566_887_1744 265
17 3300047319 Ga0495674_0000010 Ga0495674_0000010_41521_42396 265
18 3300005719 Ga0068861_100144083 Ga0068861_1001440832 267
19 3300006173 Ga0070716_100134807 Ga0070716_1001348071 267
20 3300009176 Ga0105242_10000059 Ga0105242_1000005932 267
21 3300025934 Ga0207686_10000116 Ga0207686_1000011615 267
22 3300025939 Ga0207665_10056277 Ga0207665_100562774 267
23 3300026118 Ga0207675_100158829 Ga0207675_1001588292 267
24 3300046461 Ga0495641_0014932 Ga0495641_0014932_781_1644 267
25 3300046476 Ga0495662_0000051 Ga0495662_0000051_26478_27347 267
26 3300046681 Ga0495647_0001340 Ga0495647_0001340_5424_6302 267
27 3300048905 Ga0496102_0000294 Ga0496102_0000294_57617_58510 267
28 3300048906 Ga0496103_0000159 Ga0496103_0000159_5679_6572 267
29 3300053083 Ga0495655_0000002 Ga0495655_0000002_42062_42928 267
30 3300053129 Ga0500628_000001 Ga0500628_000001_130732_131598 267
31 3300005335 Ga0070666_10029084 Ga0070666_100290842 269
32 3300025903 Ga0207680_10004019 Ga0207680_100040198 269
33 3300046533 Ga0495640_0004202 Ga0495640_0004202_6037_6894 269
34 3300049578 Ga0501042_0052635 Ga0501042_0052635_1984_2880 269
35 3300009101 Ga0105247_10001118 Ga0105247_100011186 270
36 3300025900 Ga0207710_10000451 Ga0207710_100004514 270
37 3300017792 Ga0163161_10057205 Ga0163161_100572054 272
38 3300013297 Ga0157378_10043543 Ga0157378_100435432 273
39 3300005468 Ga0070707_100074431 Ga0070707_1000744313 274
40 3300005618 Ga0068864_100000090 Ga0068864_1000000908 274
41 3300013296 Ga0157374_10005364 Ga0157374_100053649 274
42 3300026095 Ga0207676_10000016 Ga0207676_10000016225 274
43 3300046529 Ga0495652_0000010 Ga0495652_0000010_161309_162238 274
44 3300048918 Ga0496115_0000011 Ga0496115_0000011_169861_170730 274
45 3300053077 Ga0495601_0028216 Ga0495601_0028216_56_985 274
46 3300005367 Ga0070667_100219033 Ga0070667_1002190331 275
47 3300046517 Ga0495630_0136585 Ga0495630_0136585_950_1816 275
48 3300048911 Ga0496108_0149279 Ga0496108_0149279_294_1127 275
49 3300048916 Ga0496113_0018687 Ga0496113_0018687_2422_3255 275
50 3300009553 Ga0105249_10165574 Ga0105249_101655742 276
51 3300005341 Ga0070691_10003169 Ga0070691_100031697 280
52 3300046691 Ga0495670_0021967 Ga0495670_0021967_31_885 282
53 3300048907 Ga0496104_0000015 Ga0496104_0000015_145636_146583 282
54 3300048908 Ga0496105_0000004 Ga0496105_0000004_329216_330163 282
55 3300048922 Ga0496119_0051987 Ga0496119_0051987_758_1705 282
56 3300005842 Ga0068858_100000065 Ga0068858_10000006573 283
57 3300011119 Ga0105246_10044904 Ga0105246_100449043 283
58 3300026035 Ga0207703_10000018 Ga0207703_1000001873 283
59 3300046455 Ga0495603_0001505 Ga0495603_0001505_236_1099 283
60 3300046511 Ga0495608_0009930 Ga0495608_0009930_4538_5401 283
61 3300046681 Ga0495647_0003737 Ga0495647_0003737_1548_2405 283
62 3300005983 Ga0081540_1000006 Ga0081540_100000615 284
63 3300028563 Ga0265319_1000014 Ga0265319_1000014135 284
64 3300028800 Ga0265338_10000244 Ga0265338_1000024411 284
65 3300031241 Ga0265325_10034176 Ga0265325_100341763 284
66 3300031250 Ga0265331_10032062 Ga0265331_100320621 284
67 3300046471 Ga0495650_0000012 Ga0495650_0000012_183274_184143 284
68 3300046499 Ga0495594_0000032 Ga0495594_0000032_4505_5371 284
69 3300046557 Ga0495622_0000014 Ga0495622_0000014_171957_172823 284
70 3300046642 Ga0495634_0002178 Ga0495634_0002178_4751_5611 284
71 3300053085 Ga0495619_0000025 Ga0495619_0000025_162160_163026 284
72 3300005329 Ga0070683_100052069 Ga0070683_1000520692 285
73 3300005615 Ga0070702_100265292 Ga0070702_1002652922 285
74 3300005718 Ga0068866_10015274 Ga0068866_100152742 285
75 3300006844 Ga0075428_100508241 Ga0075428_1005082412 285
76 3300013104 Ga0157370_10004542 Ga0157370_100045426 285
77 3300025899 Ga0207642_10014387 Ga0207642_100143872 285
78 3300025909 Ga0207705_10023847 Ga0207705_100238471 285
79 3300025944 Ga0207661_10003275 Ga0207661_100032753 285
80 3300028556 Ga0265337_1019562 Ga0265337_10195623 285
81 3300028558 Ga0265326_10023010 Ga0265326_100230103 285
82 3300028563 Ga0265319_1000875 Ga0265319_100087513 285
83 3300028666 Ga0265336_10000153 Ga0265336_1000015337 285
84 3300028800 Ga0265338_10000935 Ga0265338_100009359 285
85 3300029957 Ga0265324_10011511 Ga0265324_100115112 285
86 3300031247 Ga0265340_10000066 Ga0265340_100000669 285
87 3300031249 Ga0265339_10054430 Ga0265339_100544302 285
88 3300031344 Ga0265316_10060031 Ga0265316_100600312 285
89 3300046459 Ga0495629_0001620 Ga0495629_0001620_6534_7400 285
90 3300046516 Ga0495628_0010925 Ga0495628_0010925_1204_2085 285
91 3300046517 Ga0495630_0000020 Ga0495630_0000020_130750_131628 285
92 3300047321 Ga0495676_0000186 Ga0495676_0000186_34472_35338 285
93 3300047322 Ga0495680_0016128 Ga0495680_0016128_3121_3993 285
94 3300048903 Ga0496100_0000001 Ga0496100_0000001_313304_314170 285
95 3300048904 Ga0496101_0000004 Ga0496101_0000004_114656_115522 285
96 3300048909 Ga0496106_0000056 Ga0496106_0000056_35629_36495 285
97 3300048910 Ga0496107_0000005 Ga0496107_0000005_216078_216944 285
98 3300048913 Ga0496110_0010673 Ga0496110_0010673_728_1615 285
99 3300048914 Ga0496111_0218280 Ga0496111_0218280_461_1348 285
100 3300048922 Ga0496119_0009550 Ga0496119_0009550_4940_5881 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05448

AXE1

Acetyl xylan esterase (AXE1)

104

176

0.9

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

60

297

0.89

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

46

278

0.86

PF01738

DLH

Dienelactone hydrolase family

46

176

0.83

PF12146

Hydrolase_4

Serine aminopeptidase, S33

56

295

0.83

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

62

305

0.55

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.8299 2 283
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.8223 2 279
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.8155 2 283
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.8154 2 279
7q4j-assembly1.cif.gz_B a thermostable lipase from thermoanaerobacter thermohydrosulfuricus in complex a monoacylglycerol intermediate 0.8048 2 285
ID Description Score Start End Superfamily
2hdwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8499 2 282 3.40.50.1820
af_P9WLC7_41_273_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8319 3 276 3.40.50.1820
af_A0A0R0EWP2_30_290_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8234 2 90 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8213 3 90 3.40.50.12270
af_C0H4R4_26_229_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.819 6 260 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3D2BVG9-F1-model_v4 Alpha/beta hydrolase 0.9121 2 131 GO:0052689
AF-A0A3D2N8D8-F1-model_v4 deleted 0.9072 2 130
AF-W1UUJ3-F1-model_v4 deleted 0.9067 2 130
AF-A0A366JGN6-F1-model_v4 X-Pro dipeptidyl-peptidase-like protein 0.8885 1 132 GO:0052689
AF-A0A2M7U7G9-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.8877 4 131

Feature Viewer

pLDDT pTM Quality
72.66 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map