F488308

General Info

Members Datasets Scaffolds Average Seq Length
1018 310 1018 189

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100069319|Ga0070706_1000693192
Length 208
Sequence MQDSKESPITKSTGRVLHMAQKPTAKKTVAEDPRYTQALQSYESGLRAMQEHKFDKAKPHFQKVVAGPSKELTDRANVHLNICNQHLERSATTQFKTAEEHFDYAVSLMNIGDYVTAREHLEKLLKQNAKSDYVVYGLAALDCLTGHVEDSLKHLDEALRLNAQLRFQARNDSDFQNLAEDPRFTELLYPDPGAELGAADGLGEEEPV

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
132 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
133 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
134 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
214 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
215 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
218 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
227 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
228 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
229 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
230 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
262 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 2.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.39
Rhizosphere 93.03
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8075501 2162886012 Unclassified 1162
2 JGI24751J29686_10001273 3300002459 Bacteria 5312
3 Ga0058863_11541540 3300004799 Bacteria 1390
4 Ga0058861_11821206 3300004800 Unclassified 1368
5 Ga0058861_11967417 3300004800 Bacteria 1267
6 Ga0058860_11978086 3300004801 Unclassified 826
7 Ga0058862_12820738 3300004803 Bacteria 1222
8 Ga0058862_12834571 3300004803 Unclassified 1429
9 Ga0065712_10086293 3300005290 Bacteria 2629
10 Ga0065715_10236585 3300005293 Bacteria 1214
11 Ga0070658_10069011 3300005327 Bacteria 2891
12 Ga0070676_10004549 3300005328 Bacteria 7308
13 Ga0070676_10105639 3300005328 Bacteria 1746
14 Ga0070683_100011357 3300005329 Bacteria 7695
15 Ga0070683_100056407 3300005329 Unclassified 3648
16 Ga0070683_100073917 3300005329 Bacteria 3183
17 Ga0070683_100109583 3300005329 Bacteria 2604
18 Ga0070690_100006782 3300005330 Bacteria 6512
19 Ga0070690_100042518 3300005330 Bacteria 2878
20 Ga0070690_100149109 3300005330 Bacteria 1594
21 Ga0070670_100008946 3300005331 Bacteria 8554
22 Ga0070670_100055647 3300005331 Bacteria 3396
23 Ga0070670_100116293 3300005331 Bacteria 2306
24 Ga0068869_100029232 3300005334 Unclassified 3860
25 Ga0068869_100038435 3300005334 Unclassified 3412
26 Ga0068869_100089885 3300005334 Bacteria 2307
27 Ga0068869_100173917 3300005334 Bacteria 1684
28 Ga0068869_100244958 3300005334 Bacteria 1429
29 Ga0070666_10010790 3300005335 Bacteria 5719
30 Ga0070666_10054046 3300005335 Bacteria 2709
31 Ga0070666_10265759 3300005335 Unclassified 1217
32 Ga0070680_100106362 3300005336 Bacteria 2333
33 Ga0070680_100235706 3300005336 Bacteria 1546
34 Ga0070682_100012261 3300005337 Bacteria 4909
35 Ga0070682_100016275 3300005337 Bacteria 4322
36 Ga0070682_100060121 3300005337 Unclassified 2403
37 Ga0068868_100037844 3300005338 Unclassified 3742
38 Ga0068868_100040602 3300005338 Bacteria 3622
39 Ga0068868_100057200 3300005338 Unclassified 3080
40 Ga0068868_100083073 3300005338 Unclassified 2570
41 Ga0068868_100090258 3300005338 Bacteria 2467
42 Ga0068868_100175989 3300005338 Bacteria 1773
43 Ga0068868_100272670 3300005338 Bacteria 1430
44 Ga0070660_100015581 3300005339 Bacteria 5493
45 Ga0070660_100019827 3300005339 Unclassified 4933
46 Ga0070660_100068642 3300005339 Bacteria 2763
47 Ga0070689_100040309 3300005340 Unclassified 3580
48 Ga0070689_100438618 3300005340 Unclassified 1109
49 Ga0070691_10107415 3300005341 Bacteria 1393
50 Ga0070687_100001627 3300005343 Bacteria 8003
51 Ga0070661_100007433 3300005344 Bacteria 7554
52 Ga0070661_100022951 3300005344 Bacteria 4469
53 Ga0070661_100282225 3300005344 Bacteria 1289
54 Ga0070661_100433625 3300005344 Unclassified 1043
55 Ga0070661_100546227 3300005344 Unclassified 932
56 Ga0070692_10061273 3300005345 Bacteria 1983
57 Ga0070668_100043770 3300005347 Bacteria 3433
58 Ga0070668_100108119 3300005347 Bacteria 2211
59 Ga0070668_100760337 3300005347 Unclassified 858
60 Ga0070669_100068238 3300005353 Bacteria 2624
61 Ga0070669_100202873 3300005353 Bacteria 1561
62 Ga0070675_100023143 3300005354 Unclassified 4964
63 Ga0070675_100403856 3300005354 Unclassified 1219
64 Ga0070671_100057674 3300005355 Bacteria 3232
65 Ga0070671_100122010 3300005355 Bacteria 2193
66 Ga0070674_100018353 3300005356 Bacteria 4422
67 Ga0070673_100008843 3300005364 Bacteria 6726
68 Ga0070673_100042242 3300005364 Unclassified 3514
69 Ga0070688_100009674 3300005365 Bacteria 5286
70 Ga0070659_100010808 3300005366 Bacteria 6733
71 Ga0070659_100028466 3300005366 Bacteria 4315
72 Ga0070659_100028812 3300005366 Unclassified 4289
73 Ga0070659_100700216 3300005366 Unclassified 876
74 Ga0070667_100018917 3300005367 Bacteria 5711
75 Ga0070667_100241782 3300005367 Bacteria 1612
76 Ga0070667_100741985 3300005367 Unclassified 910
77 Ga0070667_100744516 3300005367 Unclassified 908
78 Ga0070667_100906509 3300005367 Unclassified 821
79 Ga0070709_10003196 3300005434 Bacteria 8792
80 Ga0070709_10023873 3300005434 Unclassified 3596
81 Ga0070709_10033980 3300005434 Bacteria 3089
82 Ga0070709_10070113 3300005434 Bacteria 2259
83 Ga0070709_10508767 3300005434 Unclassified 916
84 Ga0070714_100000801 3300005435 Bacteria 22250
85 Ga0070714_100003775 3300005435 Bacteria 11364
86 Ga0070714_100097891 3300005435 Unclassified 2580
87 Ga0070714_100244840 3300005435 Bacteria 1656
88 Ga0070714_100257715 3300005435 Bacteria 1614
89 Ga0070714_100448607 3300005435 Unclassified 1225
90 Ga0070713_100000569 3300005436 Bacteria 23377
91 Ga0070713_100009328 3300005436 Bacteria 7016
92 Ga0070713_100074368 3300005436 Unclassified 2878
93 Ga0070713_100164175 3300005436 Bacteria 1985
94 Ga0070713_100168656 3300005436 Bacteria 1959
95 Ga0070713_100192372 3300005436 Bacteria 1839
96 Ga0070713_100242057 3300005436 Unclassified 1643
97 Ga0070713_100245534 3300005436 Bacteria 1631
98 Ga0070713_100329561 3300005436 Unclassified 1412
99 Ga0070713_100917487 3300005436 Unclassified 843
100 Ga0070713_101290489 3300005436 Bacteria 707
101 Ga0070710_10010073 3300005437 Bacteria 4636
102 Ga0070710_10021673 3300005437 Bacteria 3352
103 Ga0070710_10029956 3300005437 Bacteria 2924
104 Ga0070710_10082745 3300005437 Unclassified 1877
105 Ga0070710_10262749 3300005437 Bacteria 1114
106 Ga0070711_100003297 3300005439 Bacteria 9397
107 Ga0070711_100006867 3300005439 Bacteria 6894
108 Ga0070711_100030092 3300005439 Bacteria 3591
109 Ga0070711_100174826 3300005439 Bacteria 1639
110 Ga0070711_100256528 3300005439 Bacteria 1374
111 Ga0070711_100281402 3300005439 Bacteria 1316
112 Ga0070711_100798451 3300005439 Unclassified 800
113 Ga0070705_100067854 3300005440 Unclassified 2144
114 Ga0070694_100270029 3300005444 Bacteria 1293
115 Ga0070708_100005568 3300005445 Bacteria 9979
116 Ga0070708_100013578 3300005445 Bacteria 6675
117 Ga0070708_100016686 3300005445 Bacteria 6101
118 Ga0070708_100018605 3300005445 Bacteria 5815
119 Ga0070708_100103449 3300005445 Bacteria 2610
120 Ga0070708_100425606 3300005445 Bacteria 1252
121 Ga0070708_100632224 3300005445 Unclassified 1009
122 Ga0070663_100085535 3300005455 Bacteria 2327
123 Ga0070663_100096309 3300005455 Bacteria 2201
124 Ga0070678_100301407 3300005456 Unclassified 1362
125 Ga0070678_100677526 3300005456 Bacteria 927
126 Ga0070662_100001509 3300005457 Bacteria 14305
127 Ga0070662_100016025 3300005457 Bacteria 5029
128 Ga0070662_100606752 3300005457 Unclassified 921
129 Ga0070681_10000026 3300005458 Bacteria 107615
130 Ga0070681_10003878 3300005458 Bacteria 14076
131 Ga0070681_10024591 3300005458 Bacteria 6059
132 Ga0070681_10072813 3300005458 Bacteria 3398
133 Ga0070681_10074313 3300005458 Bacteria 3360
134 Ga0070681_10101548 3300005458 Bacteria 2822
135 Ga0070681_10424738 3300005458 Bacteria 1241
136 Ga0068867_100018978 3300005459 Unclassified 4895
137 Ga0068867_100026637 3300005459 Unclassified 4152
138 Ga0068867_100061067 3300005459 Bacteria 2797
139 Ga0070685_10000797 3300005466 Bacteria 17094
140 Ga0070685_10066079 3300005466 Bacteria 2130
141 Ga0070706_100000454 3300005467 Bacteria 48917
142 Ga0070706_100002171 3300005467 Bacteria 19943
143 Ga0070706_100033498 3300005467 Bacteria 4741
144 Ga0070706_100069319 3300005467 Bacteria 3262
145 Ga0070706_100089643 3300005467 Bacteria 2852
146 Ga0070706_100102492 3300005467 Bacteria 2661
147 Ga0070707_100001443 3300005468 Bacteria 23285
148 Ga0070707_100010916 3300005468 Bacteria 8458
149 Ga0070707_100031745 3300005468 Bacteria 5032
150 Ga0070707_100053245 3300005468 Bacteria 3879
151 Ga0070707_100300742 3300005468 Bacteria 1559
152 Ga0070707_100309713 3300005468 Unclassified 1535
153 Ga0070707_101027885 3300005468 Unclassified 789
154 Ga0070698_100000216 3300005471 Bacteria 56257
155 Ga0070698_100161985 3300005471 Bacteria 2181
156 Ga0070698_100833582 3300005471 Unclassified 867
157 Ga0070699_100017274 3300005518 Bacteria 6195
158 Ga0070679_100012185 3300005530 Bacteria 8212
159 Ga0070679_100028646 3300005530 Bacteria 5492
160 Ga0070679_100051762 3300005530 Unclassified 4090
161 Ga0070679_100070772 3300005530 Bacteria 3480
162 Ga0070679_100103365 3300005530 Bacteria 2835
163 Ga0070679_100474383 3300005530 Unclassified 1195
164 Ga0070684_100004113 3300005535 Bacteria 11006
165 Ga0070684_100036867 3300005535 Bacteria 4192
166 Ga0070684_100069961 3300005535 Unclassified 3087
167 Ga0070684_100121704 3300005535 Unclassified 2348
168 Ga0070684_100132654 3300005535 Bacteria 2247
169 Ga0070697_100001523 3300005536 Bacteria 17629
170 Ga0070697_100055246 3300005536 Bacteria 3228
171 Ga0070697_100092384 3300005536 Unclassified 2504
172 Ga0070697_100199755 3300005536 Unclassified 1699
173 Ga0070697_100380771 3300005536 Bacteria 1222
174 Ga0070697_100562381 3300005536 Bacteria 1000
175 Ga0070697_100637354 3300005536 Unclassified 938
176 Ga0070697_100642296 3300005536 Bacteria 934
177 Ga0068853_100006912 3300005539 Bacteria 9059
178 Ga0068853_100012490 3300005539 Bacteria 6909
179 Ga0068853_100040217 3300005539 Bacteria 3988
180 Ga0068853_100064187 3300005539 Bacteria 3183
181 Ga0068853_100077536 3300005539 Bacteria 2903
182 Ga0068853_100118454 3300005539 Unclassified 2360
183 Ga0068853_100317779 3300005539 Bacteria 1443
184 Ga0070672_100048312 3300005543 Bacteria 3306
185 Ga0070672_100572206 3300005543 Unclassified 982
186 Ga0070686_100010765 3300005544 Bacteria 5171
187 Ga0070695_100013438 3300005545 Bacteria 4920
188 Ga0070695_100210979 3300005545 Unclassified 1394
189 Ga0070696_100168212 3300005546 Bacteria 1619
190 Ga0070696_100335292 3300005546 Bacteria 1167
191 Ga0070693_100009042 3300005547 Bacteria 4943
192 Ga0070693_100072316 3300005547 Bacteria 2034
193 Ga0070693_100441959 3300005547 Bacteria 911
194 Ga0070693_100841538 3300005547 Unclassified 683
195 Ga0070665_100050113 3300005548 Bacteria 4190
196 Ga0070665_100429110 3300005548 Unclassified 1331
197 Ga0070704_100461517 3300005549 Unclassified 1096
198 Ga0068855_100000295 3300005563 Bacteria 61909
199 Ga0068855_100018006 3300005563 Bacteria 8488
200 Ga0068855_100043827 3300005563 Bacteria 5297
201 Ga0068855_100054917 3300005563 Unclassified 4680
202 Ga0068855_100139353 3300005563 Unclassified 2766
203 Ga0068855_100166960 3300005563 Bacteria 2494
204 Ga0068855_100222675 3300005563 Unclassified 2115
205 Ga0068855_100373419 3300005563 Unclassified 1567
206 Ga0068855_100398673 3300005563 Bacteria 1508
207 Ga0070664_100000687 3300005564 Bacteria 25824
208 Ga0070664_100018900 3300005564 Bacteria 5666
209 Ga0070664_100049580 3300005564 Bacteria 3551
210 Ga0070664_100266771 3300005564 Bacteria 1541
211 Ga0070664_100493833 3300005564 Unclassified 1128
212 Ga0068857_100001872 3300005577 Bacteria 16933
213 Ga0068857_100002428 3300005577 Bacteria 15213
214 Ga0068857_100010663 3300005577 Bacteria 7994
215 Ga0068857_100056730 3300005577 Bacteria 3476
216 Ga0068857_100202557 3300005577 Bacteria 1809
217 Ga0068857_100286927 3300005577 Bacteria 1515
218 Ga0068854_100023329 3300005578 Unclassified 4225
219 Ga0068854_100028511 3300005578 Bacteria 3858
220 Ga0068854_100050952 3300005578 Unclassified 2964
221 Ga0068854_100089977 3300005578 Bacteria 2282
222 Ga0068854_100161548 3300005578 Bacteria 1735
223 Ga0068854_100754427 3300005578 Unclassified 844
224 Ga0068856_100000407 3300005614 Bacteria 47326
225 Ga0068856_100000574 3300005614 Bacteria 40092
226 Ga0068856_100002064 3300005614 Bacteria 20820
227 Ga0068856_100006032 3300005614 Bacteria 11919
228 Ga0068856_100009749 3300005614 Bacteria 9330
229 Ga0068856_100048394 3300005614 Bacteria 4189
230 Ga0068856_100106639 3300005614 Bacteria 2797
231 Ga0068856_100193997 3300005614 Bacteria 2045
232 Ga0068856_100307703 3300005614 Unclassified 1602
233 Ga0068856_100456165 3300005614 Unclassified 1299
234 Ga0068852_100007670 3300005616 Bacteria 7894
235 Ga0068852_100097203 3300005616 Unclassified 2648
236 Ga0068852_100116779 3300005616 Bacteria 2435
237 Ga0068852_100163911 3300005616 Unclassified 2078
238 Ga0068852_100180529 3300005616 Bacteria 1984
239 Ga0068852_100319699 3300005616 Unclassified 1507
240 Ga0068852_100528851 3300005616 Bacteria 1177
241 Ga0068859_100015249 3300005617 Bacteria 7717
242 Ga0068859_100039953 3300005617 Unclassified 4709
243 Ga0068864_100000684 3300005618 Bacteria 28437
244 Ga0068864_100079900 3300005618 Unclassified 2864
245 Ga0068864_100271583 3300005618 Bacteria 1580
246 Ga0068866_10016537 3300005718 Bacteria 3299
247 Ga0068866_10021658 3300005718 Bacteria 2964
248 Ga0068866_10021829 3300005718 Unclassified 2954
249 Ga0068866_10022138 3300005718 Unclassified 2938
250 Ga0068861_100061273 3300005719 Bacteria 2887
251 Ga0068851_10007945 3300005834 Bacteria 4891
252 Ga0068851_10032375 3300005834 Bacteria 2602
253 Ga0068870_10014885 3300005840 Bacteria 3683
254 Ga0068870_10037683 3300005840 Unclassified 2493
255 Ga0068863_100012509 3300005841 Bacteria 8191
256 Ga0068863_100038509 3300005841 Bacteria 4549
257 Ga0068863_100056594 3300005841 Bacteria 3712
258 Ga0068863_100058737 3300005841 Bacteria 3640
259 Ga0068863_100178505 3300005841 Bacteria 2038
260 Ga0068863_100186987 3300005841 Bacteria 1990
261 Ga0068858_100003346 3300005842 Bacteria 15959
262 Ga0068858_100009627 3300005842 Bacteria 9210
263 Ga0068858_100026465 3300005842 Bacteria 5388
264 Ga0068858_100197436 3300005842 Bacteria 1902
265 Ga0068858_100233188 3300005842 Bacteria 1745
266 Ga0068858_100702272 3300005842 Unclassified 984
267 Ga0068860_100024585 3300005843 Bacteria 5818
268 Ga0068860_100035179 3300005843 Unclassified 4806
269 Ga0068860_100040235 3300005843 Bacteria 4469
270 Ga0068860_100060161 3300005843 Bacteria 3610
271 Ga0068862_100089621 3300005844 Bacteria 2677
272 Ga0068862_100154125 3300005844 Unclassified 2047
273 Ga0068862_100215943 3300005844 Bacteria 1735
274 Ga0081540_1060056 3300005983 Unclassified 1821
275 Ga0081540_1079668 3300005983 Bacteria 1480
276 Ga0070717_10016710 3300006028 Bacteria 5696
277 Ga0070717_10019684 3300006028 Bacteria 5298
278 Ga0070717_10022998 3300006028 Bacteria 4932
279 Ga0070717_10039792 3300006028 Bacteria 3826
280 Ga0070717_10191634 3300006028 Unclassified 1786
281 Ga0070717_10202152 3300006028 Bacteria 1741
282 Ga0070717_10329442 3300006028 Bacteria 1362
283 Ga0070717_10406145 3300006028 Bacteria 1224
284 Ga0070717_10473219 3300006028 Bacteria 1131
285 Ga0070717_10974984 3300006028 Bacteria 772
286 Ga0070715_10020920 3300006163 Unclassified 2530
287 Ga0070715_10033486 3300006163 Unclassified 2100
288 Ga0070715_10054611 3300006163 Unclassified 1731
289 Ga0070715_10131266 3300006163 Bacteria 1206
290 Ga0070716_100000426 3300006173 Bacteria 17432
291 Ga0070716_100009551 3300006173 Unclassified 4836
292 Ga0070716_100013373 3300006173 Bacteria 4181
293 Ga0070716_100031549 3300006173 Bacteria 2882
294 Ga0070716_100035419 3300006173 Bacteria 2744
295 Ga0070716_100039461 3300006173 Unclassified 2621
296 Ga0070716_100040899 3300006173 Bacteria 2580
297 Ga0070716_100042771 3300006173 Bacteria 2530
298 Ga0070716_100291271 3300006173 Bacteria 1131
299 Ga0070716_100341712 3300006173 Unclassified 1056
300 Ga0070712_100000375 3300006175 Bacteria 25335
301 Ga0070712_100000708 3300006175 Bacteria 19645
302 Ga0070712_100000952 3300006175 Bacteria 17401
303 Ga0070712_100001820 3300006175 Bacteria 12980
304 Ga0070712_100089564 3300006175 Bacteria 2251
305 Ga0070712_100153506 3300006175 Bacteria 1770
306 Ga0070712_100173881 3300006175 Unclassified 1673
307 Ga0070712_100884971 3300006175 Bacteria 769
308 Ga0070712_100996098 3300006175 Unclassified 725
309 Ga0097621_100000237 3300006237 Bacteria 37036
310 Ga0097621_100078861 3300006237 Bacteria 2736
311 Ga0097621_100131172 3300006237 Bacteria 2133
312 Ga0097621_100138738 3300006237 Bacteria 2076
313 Ga0097621_100292498 3300006237 Bacteria 1436
314 Ga0068871_100001254 3300006358 Bacteria 16960
315 Ga0068871_100003099 3300006358 Bacteria 11410
316 Ga0068871_100017377 3300006358 Bacteria 5442
317 Ga0068871_100025052 3300006358 Bacteria 4636
318 Ga0068871_100125464 3300006358 Unclassified 2172
319 Ga0068871_100199812 3300006358 Bacteria 1725
320 Ga0068871_100254468 3300006358 Unclassified 1530
321 Ga0068871_100361836 3300006358 Bacteria 1285
322 Ga0075433_10020011 3300006852 Bacteria 5590
323 Ga0075433_10067212 3300006852 Unclassified 3146
324 Ga0075433_10474415 3300006852 Bacteria 1102
325 Ga0075434_100000460 3300006871 Bacteria 30424
326 Ga0075434_100003658 3300006871 Bacteria 13733
327 Ga0075434_100039922 3300006871 Bacteria 4648
328 Ga0068865_100008049 3300006881 Bacteria 6508
329 Ga0068865_100024968 3300006881 Unclassified 3926
330 Ga0068865_100134911 3300006881 Bacteria 1853
331 Ga0068865_100385278 3300006881 Bacteria 1144
332 Ga0068865_100527383 3300006881 Unclassified 988
333 Ga0075436_100002468 3300006914 Bacteria 12728
334 Ga0075436_100010225 3300006914 Bacteria 6425
335 Ga0075436_100164013 3300006914 Bacteria 1567
336 Ga0097620_100015248 3300006931 Bacteria 7717
337 Ga0097620_100039953 3300006931 Unclassified 4709
338 Ga0075435_100000141 3300007076 Bacteria 40680
339 Ga0075435_100052825 3300007076 Bacteria 3275
340 Ga0075435_100321593 3300007076 Bacteria 1324
341 Ga0099794_10130754 3300007265 Bacteria 1267
342 Ga0105251_10187492 3300009011 Bacteria 931
343 Ga0105250_10103101 3300009092 Unclassified 1165
344 Ga0105250_10122046 3300009092 Bacteria 1072
345 Ga0105240_10007038 3300009093 Bacteria 16411
346 Ga0105240_10023147 3300009093 Bacteria 8225
347 Ga0105240_10063883 3300009093 Unclassified 4577
348 Ga0105240_10078754 3300009093 Bacteria 4057
349 Ga0105240_10088126 3300009093 Bacteria 3799
350 Ga0105240_10287080 3300009093 Bacteria 1888
351 Ga0105240_10331301 3300009093 Bacteria 1732
352 Ga0105240_11125776 3300009093 Unclassified 834
353 Ga0111539_10415590 3300009094 Bacteria 1567
354 Ga0105245_10059246 3300009098 Bacteria 3448
355 Ga0105245_10062536 3300009098 Bacteria 3359
356 Ga0105245_10070411 3300009098 Bacteria 3173
357 Ga0105245_10322498 3300009098 Unclassified 1522
358 Ga0105247_10001613 3300009101 Bacteria 15966
359 Ga0105247_10025257 3300009101 Unclassified 3584
360 Ga0105247_10038216 3300009101 Bacteria 2929
361 Ga0105247_10766230 3300009101 Unclassified 733
362 Ga0105243_10295434 3300009148 Bacteria 1466
363 Ga0105243_10858585 3300009148 Bacteria 899
364 Ga0105243_11132394 3300009148 Unclassified 792
365 Ga0105241_10000910 3300009174 Bacteria 22369
366 Ga0105241_10023344 3300009174 Unclassified 4586
367 Ga0105241_10026676 3300009174 Bacteria 4300
368 Ga0105241_10034557 3300009174 Bacteria 3799
369 Ga0105241_10050807 3300009174 Bacteria 3160
370 Ga0105241_10085581 3300009174 Bacteria 2478
371 Ga0105241_10086055 3300009174 Bacteria 2471
372 Ga0105241_10122990 3300009174 Unclassified 2092
373 Ga0105241_10218798 3300009174 Bacteria 1599
374 Ga0105241_10258244 3300009174 Unclassified 1480
375 Ga0105241_10429685 3300009174 Bacteria 1164
376 Ga0105242_10045283 3300009176 Bacteria 3565
377 Ga0105242_10081210 3300009176 Bacteria 2711
378 Ga0105242_10498187 3300009176 Unclassified 1158
379 Ga0105242_11054714 3300009176 Unclassified 824
380 Ga0105248_10013380 3300009177 Bacteria 9031
381 Ga0105248_10023146 3300009177 Bacteria 6900
382 Ga0105248_10077736 3300009177 Unclassified 3731
383 Ga0105248_10111178 3300009177 Unclassified 3090
384 Ga0105248_10119859 3300009177 Bacteria 2968
385 Ga0105248_10168518 3300009177 Unclassified 2468
386 Ga0105248_10344950 3300009177 Bacteria 1676
387 Ga0105248_10734650 3300009177 Unclassified 1114
388 Ga0105237_10021829 3300009545 Bacteria 6576
389 Ga0105237_10022977 3300009545 Bacteria 6395
390 Ga0105237_10299535 3300009545 Unclassified 1611
391 Ga0105237_11027503 3300009545 Bacteria 831
392 Ga0105237_11498039 3300009545 Unclassified 681
393 Ga0105238_10000188 3300009551 Bacteria 68217
394 Ga0105238_10016920 3300009551 Bacteria 7400
395 Ga0105238_10023454 3300009551 Bacteria 6290
396 Ga0105238_10037684 3300009551 Bacteria 4914
397 Ga0105238_10055918 3300009551 Bacteria 3959
398 Ga0105249_10006286 3300009553 Bacteria 10317
399 Ga0105249_10025448 3300009553 Bacteria 5328
400 Ga0105249_10034638 3300009553 Bacteria 4576
401 Ga0105249_10961789 3300009553 Unclassified 922
402 Ga0105239_10009528 3300010375 Bacteria 10931
403 Ga0105239_10059067 3300010375 Bacteria 4209
404 Ga0105239_10080930 3300010375 Bacteria 3574
405 Ga0105239_10373781 3300010375 Unclassified 1611
406 Ga0105246_10065236 3300011119 Bacteria 2546
407 Ga0105246_10091932 3300011119 Bacteria 2188
408 Ga0157324_1013069 3300012506 Unclassified 745
409 Ga0157373_10001291 3300013100 Bacteria 19116
410 Ga0157373_10013739 3300013100 Bacteria 5936
411 Ga0157373_10032458 3300013100 Bacteria 3759
412 Ga0157373_10106830 3300013100 Bacteria 1968
413 Ga0157373_10130589 3300013100 Unclassified 1767
414 Ga0157373_10135455 3300013100 Unclassified 1732
415 Ga0157373_10189097 3300013100 Unclassified 1451
416 Ga0157371_10010976 3300013102 Bacteria 7020
417 Ga0157371_10185360 3300013102 Bacteria 1489
418 Ga0157371_10405826 3300013102 Unclassified 997
419 Ga0157371_10603082 3300013102 Unclassified 817
420 Ga0157370_10011537 3300013104 Bacteria 9228
421 Ga0157370_10025983 3300013104 Bacteria 5787
422 Ga0157370_10297528 3300013104 Unclassified 1490
423 Ga0157369_10000124 3300013105 Bacteria 110693
424 Ga0157369_10013546 3300013105 Bacteria 9217
425 Ga0157369_10026095 3300013105 Bacteria 6482
426 Ga0157369_10030134 3300013105 Bacteria 5986
427 Ga0157369_10059396 3300013105 Bacteria 4123
428 Ga0157369_10115306 3300013105 Unclassified 2853
429 Ga0157369_10250963 3300013105 Bacteria 1847
430 Ga0157374_10000162 3300013296 Bacteria 61913
431 Ga0157374_10000582 3300013296 Bacteria 32362
432 Ga0157374_10002038 3300013296 Bacteria 16970
433 Ga0157374_10007625 3300013296 Bacteria 9238
434 Ga0157374_10022134 3300013296 Bacteria 5667
435 Ga0157374_10053221 3300013296 Unclassified 3773
436 Ga0157374_10072470 3300013296 Bacteria 3250
437 Ga0157374_10239140 3300013296 Bacteria 1785
438 Ga0157374_10311953 3300013296 Bacteria 1557
439 Ga0157374_10531583 3300013296 Unclassified 1182
440 Ga0157374_11442313 3300013296 Bacteria 711
441 Ga0157378_10000020 3300013297 Bacteria 131245
442 Ga0157378_10000320 3300013297 Bacteria 47177
443 Ga0157378_10003732 3300013297 Bacteria 13503
444 Ga0157378_10053001 3300013297 Unclassified 3611
445 Ga0157378_10169006 3300013297 Bacteria 2049
446 Ga0157378_10567007 3300013297 Unclassified 1143
447 Ga0157378_10859808 3300013297 Unclassified 936
448 Ga0157378_11095831 3300013297 Unclassified 833
449 Ga0163162_10001366 3300013306 Bacteria 22706
450 Ga0163162_10004521 3300013306 Bacteria 13394
451 Ga0163162_10018901 3300013306 Bacteria 6757
452 Ga0163162_10088580 3300013306 Bacteria 3174
453 Ga0163162_10425830 3300013306 Bacteria 1459
454 Ga0163162_10469048 3300013306 Bacteria 1390
455 Ga0157372_10000084 3300013307 Bacteria 98431
456 Ga0157372_10001092 3300013307 Bacteria 29537
457 Ga0157372_10001112 3300013307 Bacteria 29221
458 Ga0157372_10007677 3300013307 Bacteria 11475
459 Ga0157372_10030884 3300013307 Bacteria 5863
460 Ga0157372_10035192 3300013307 Bacteria 5511
461 Ga0157372_10052890 3300013307 Bacteria 4524
462 Ga0157372_10055764 3300013307 Unclassified 4414
463 Ga0157372_10148560 3300013307 Bacteria 2703
464 Ga0157372_10212864 3300013307 Unclassified 2240
465 Ga0157372_10340278 3300013307 Bacteria 1747
466 Ga0157372_10429140 3300013307 Bacteria 1540
467 Ga0157375_10039878 3300013308 Bacteria 4522
468 Ga0157375_10100161 3300013308 Unclassified 2977
469 Ga0163163_10005648 3300014325 Bacteria 10842
470 Ga0163163_10191042 3300014325 Unclassified 2096
471 Ga0163163_10607816 3300014325 Bacteria 1157
472 Ga0157380_10017537 3300014326 Bacteria 5300
473 Ga0182008_10008926 3300014497 Bacteria 5437
474 Ga0182008_10075420 3300014497 Unclassified 1659
475 Ga0157377_10000230 3300014745 Bacteria 29235
476 Ga0157379_10008716 3300014968 Bacteria 8838
477 Ga0157379_10017268 3300014968 Bacteria 6357
478 Ga0157379_10033479 3300014968 Bacteria 4582
479 Ga0157379_10088166 3300014968 Bacteria 2782
480 Ga0157379_10117922 3300014968 Unclassified 2388
481 Ga0157379_10462791 3300014968 Unclassified 1172
482 Ga0157376_10001784 3300014969 Bacteria 14330
483 Ga0157376_10001794 3300014969 Bacteria 14277
484 Ga0157376_10031533 3300014969 Bacteria 4246
485 Ga0157376_10049823 3300014969 Bacteria 3471
486 Ga0157376_10096542 3300014969 Bacteria 2572
487 Ga0157376_10127883 3300014969 Unclassified 2263
488 Ga0157376_10257624 3300014969 Bacteria 1632
489 Ga0182006_1109024 3300015261 Unclassified 974
490 Ga0182007_10034176 3300015262 Unclassified 1719
491 Ga0182007_10053490 3300015262 Bacteria 1329
492 Ga0182005_1038296 3300015265 Bacteria 1304
493 Ga0163161_10012941 3300017792 Bacteria 5796
494 Ga0206350_10675980 3300020080 Unclassified 1328
495 Ga0206350_11157382 3300020080 Bacteria 2636
496 Ga0213874_10071993 3300021377 Unclassified 1104
497 Ga0224712_10097972 3300022467 Bacteria 1239
498 Ga0224712_10237503 3300022467 Unclassified 838
499 Ga0224570_101218 3300022730 Unclassified 1994
500 Ga0224569_103894 3300022732 Bacteria 1155
501 Ga0224572_1019941 3300024225 Unclassified 1288
502 Ga0228598_1001017 3300024227 Bacteria 6146
503 Ga0207697_10003863 3300025315 Bacteria 7308
504 Ga0207656_10008807 3300025321 Bacteria 3731
505 Ga0207656_10019855 3300025321 Bacteria 2662
506 Ga0207692_10018782 3300025898 Unclassified 3110
507 Ga0207692_10034448 3300025898 Bacteria 2452
508 Ga0207692_10067239 3300025898 Bacteria 1875
509 Ga0207692_10076629 3300025898 Bacteria 1777
510 Ga0207692_10102483 3300025898 Bacteria 1574
511 Ga0207692_10303501 3300025898 Bacteria 972
512 Ga0207642_10004367 3300025899 Bacteria 4559
513 Ga0207642_10014085 3300025899 Unclassified 2940
514 Ga0207642_10110717 3300025899 Bacteria 1397
515 Ga0207642_10269048 3300025899 Bacteria 975
516 Ga0207710_10034258 3300025900 Bacteria 2231
517 Ga0207710_10038745 3300025900 Bacteria 2108
518 Ga0207688_10014841 3300025901 Bacteria 4227
519 Ga0207680_10101778 3300025903 Bacteria 1847
520 Ga0207680_10113856 3300025903 Bacteria 1759
521 Ga0207647_10006770 3300025904 Bacteria 8319
522 Ga0207647_10017691 3300025904 Unclassified 4841
523 Ga0207647_10031767 3300025904 Unclassified 3396
524 Ga0207685_10018401 3300025905 Bacteria 2280
525 Ga0207685_10177591 3300025905 Bacteria 985
526 Ga0207699_10000423 3300025906 Bacteria 21636
527 Ga0207699_10005111 3300025906 Bacteria 6279
528 Ga0207699_10015704 3300025906 Bacteria 3940
529 Ga0207699_10027939 3300025906 Unclassified 3130
530 Ga0207699_10182271 3300025906 Bacteria 1412
531 Ga0207699_10240810 3300025906 Unclassified 1243
532 Ga0207699_10491468 3300025906 Unclassified 885
533 Ga0207645_10000376 3300025907 Bacteria 36934
534 Ga0207645_10037470 3300025907 Bacteria 3111
535 Ga0207643_10000194 3300025908 Bacteria 41979
536 Ga0207643_10157106 3300025908 Unclassified 1366
537 Ga0207705_10046569 3300025909 Bacteria 3117
538 Ga0207684_10002803 3300025910 Bacteria 17331
539 Ga0207684_10003642 3300025910 Bacteria 14972
540 Ga0207684_10066315 3300025910 Bacteria 3066
541 Ga0207684_10128330 3300025910 Unclassified 2177
542 Ga0207684_10213260 3300025910 Unclassified 1666
543 Ga0207654_10036475 3300025911 Unclassified 2747
544 Ga0207654_10046310 3300025911 Bacteria 2480
545 Ga0207654_10049753 3300025911 Bacteria 2406
546 Ga0207654_10069633 3300025911 Unclassified 2085
547 Ga0207654_10198775 3300025911 Bacteria 1319
548 Ga0207654_10317364 3300025911 Bacteria 1064
549 Ga0207654_10420364 3300025911 Unclassified 933
550 Ga0207654_10535023 3300025911 Unclassified 831
551 Ga0207707_10000800 3300025912 Bacteria 30836
552 Ga0207707_10003464 3300025912 Bacteria 13980
553 Ga0207707_10008961 3300025912 Bacteria 8693
554 Ga0207707_10018040 3300025912 Bacteria 6148
555 Ga0207707_10034361 3300025912 Bacteria 4436
556 Ga0207707_10064483 3300025912 Unclassified 3189
557 Ga0207707_10499169 3300025912 Bacteria 1038
558 Ga0207695_10018259 3300025913 Bacteria 8116
559 Ga0207695_10028234 3300025913 Bacteria 6227
560 Ga0207695_10049830 3300025913 Bacteria 4410
561 Ga0207695_10071973 3300025913 Bacteria 3530
562 Ga0207695_10206897 3300025913 Bacteria 1875
563 Ga0207695_10475059 3300025913 Bacteria 1132
564 Ga0207671_10020926 3300025914 Bacteria 4973
565 Ga0207671_10158462 3300025914 Bacteria 1752
566 Ga0207671_10246618 3300025914 Unclassified 1404
567 Ga0207671_10522239 3300025914 Unclassified 947
568 Ga0207671_10641769 3300025914 Unclassified 846
569 Ga0207671_10851151 3300025914 Unclassified 722
570 Ga0207693_10000024 3300025915 Bacteria 125885
571 Ga0207693_10000214 3300025915 Bacteria 53256
572 Ga0207693_10001731 3300025915 Bacteria 19165
573 Ga0207693_10008124 3300025915 Bacteria 8602
574 Ga0207693_10015084 3300025915 Bacteria 6202
575 Ga0207693_10045616 3300025915 Bacteria 3444
576 Ga0207693_10195472 3300025915 Bacteria 1591
577 Ga0207693_10238573 3300025915 Unclassified 1427
578 Ga0207693_10513648 3300025915 Unclassified 935
579 Ga0207663_10007091 3300025916 Bacteria 5787
580 Ga0207663_10008315 3300025916 Bacteria 5418
581 Ga0207663_10009352 3300025916 Bacteria 5173
582 Ga0207663_10024149 3300025916 Bacteria 3498
583 Ga0207663_10077451 3300025916 Bacteria 2164
584 Ga0207663_10185342 3300025916 Unclassified 1490
585 Ga0207663_10350788 3300025916 Bacteria 1117
586 Ga0207663_10365848 3300025916 Bacteria 1095
587 Ga0207663_10617102 3300025916 Unclassified 853
588 Ga0207660_10019266 3300025917 Bacteria 4559
589 Ga0207660_10281806 3300025917 Bacteria 1319
590 Ga0207660_10336398 3300025917 Bacteria 1208
591 Ga0207660_10386048 3300025917 Bacteria 1126
592 Ga0207660_10432805 3300025917 Unclassified 1062
593 Ga0207662_10001408 3300025918 Bacteria 11646
594 Ga0207657_10002947 3300025919 Bacteria 18257
595 Ga0207657_10004279 3300025919 Bacteria 15127
596 Ga0207657_10010820 3300025919 Bacteria 9078
597 Ga0207649_10001260 3300025920 Bacteria 15148
598 Ga0207649_10037225 3300025920 Bacteria 2937
599 Ga0207649_10043965 3300025920 Bacteria 2734
600 Ga0207649_10551739 3300025920 Bacteria 882
601 Ga0207652_10052324 3300025921 Bacteria 3504
602 Ga0207652_10253362 3300025921 Unclassified 1587
603 Ga0207652_10292653 3300025921 Unclassified 1469
604 Ga0207652_10346332 3300025921 Bacteria 1341
605 Ga0207652_10887227 3300025921 Bacteria 788
606 Ga0207646_10001233 3300025922 Bacteria 32128
607 Ga0207646_10006853 3300025922 Bacteria 11711
608 Ga0207646_10120223 3300025922 Bacteria 2360
609 Ga0207646_10283858 3300025922 Bacteria 1496
610 Ga0207646_10424835 3300025922 Bacteria 1200
611 Ga0207646_10479440 3300025922 Unclassified 1122
612 Ga0207646_10749878 3300025922 Bacteria 871
613 Ga0207646_11186073 3300025922 Bacteria 670
614 Ga0207646_11394985 3300025922 Unclassified 609
615 Ga0207694_10000434 3300025924 Bacteria 38832
616 Ga0207694_10031776 3300025924 Bacteria 4035
617 Ga0207694_10065067 3300025924 Bacteria 2842
618 Ga0207650_10000216 3300025925 Bacteria 65683
619 Ga0207650_10045927 3300025925 Unclassified 3215
620 Ga0207650_10275198 3300025925 Bacteria 1369
621 Ga0207659_10178763 3300025926 Bacteria 1679
622 Ga0207687_10315703 3300025927 Unclassified 1263
623 Ga0207700_10003049 3300025928 Bacteria 9665
624 Ga0207700_10008553 3300025928 Bacteria 6350
625 Ga0207700_10009126 3300025928 Bacteria 6176
626 Ga0207700_10022345 3300025928 Bacteria 4340
627 Ga0207700_10025588 3300025928 Bacteria 4101
628 Ga0207700_10083494 3300025928 Bacteria 2501
629 Ga0207700_10115398 3300025928 Bacteria 2168
630 Ga0207700_10117120 3300025928 Unclassified 2154
631 Ga0207700_10122746 3300025928 Bacteria 2109
632 Ga0207700_10163626 3300025928 Bacteria 1850
633 Ga0207700_10187467 3300025928 Unclassified 1736
634 Ga0207700_10195915 3300025928 Unclassified 1700
635 Ga0207700_10276955 3300025928 Bacteria 1442
636 Ga0207700_10356448 3300025928 Bacteria 1275
637 Ga0207700_10478464 3300025928 Unclassified 1100
638 Ga0207700_10742627 3300025928 Unclassified 877
639 Ga0207664_10000607 3300025929 Bacteria 24798
640 Ga0207664_10003402 3300025929 Bacteria 10595
641 Ga0207664_10013520 3300025929 Bacteria 5862
642 Ga0207664_10065055 3300025929 Bacteria 2918
643 Ga0207664_10235165 3300025929 Unclassified 1594
644 Ga0207664_10242000 3300025929 Bacteria 1572
645 Ga0207664_10293729 3300025929 Bacteria 1429
646 Ga0207664_10566030 3300025929 Bacteria 1020
647 Ga0207664_11210940 3300025929 Bacteria 673
648 Ga0207644_10040273 3300025931 Bacteria 3302
649 Ga0207644_10086751 3300025931 Bacteria 2324
650 Ga0207644_10637881 3300025931 Unclassified 886
651 Ga0207690_10033647 3300025932 Bacteria 3297
652 Ga0207690_10053600 3300025932 Bacteria 2707
653 Ga0207690_10078606 3300025932 Bacteria 2296
654 Ga0207690_10253114 3300025932 Bacteria 1361
655 Ga0207706_10000868 3300025933 Bacteria 31136
656 Ga0207706_10014363 3300025933 Bacteria 7176
657 Ga0207706_10032789 3300025933 Bacteria 4623
658 Ga0207706_10097987 3300025933 Unclassified 2579
659 Ga0207686_10432009 3300025934 Unclassified 1009
660 Ga0207709_10187376 3300025935 Bacteria 1466
661 Ga0207670_10001554 3300025936 Bacteria 12083
662 Ga0207669_10036908 3300025937 Bacteria 2798
663 Ga0207704_10006939 3300025938 Bacteria 5314
664 Ga0207704_10021498 3300025938 Bacteria 3438
665 Ga0207704_10085128 3300025938 Unclassified 2057
666 Ga0207704_10631510 3300025938 Unclassified 880
667 Ga0207665_10000329 3300025939 Bacteria 32870
668 Ga0207665_10030987 3300025939 Bacteria 3538
669 Ga0207665_10037027 3300025939 Bacteria 3246
670 Ga0207665_10041249 3300025939 Bacteria 3081
671 Ga0207665_10106501 3300025939 Bacteria 1965
672 Ga0207665_10140359 3300025939 Unclassified 1722
673 Ga0207665_10212331 3300025939 Unclassified 1414
674 Ga0207665_10214247 3300025939 Bacteria 1409
675 Ga0207665_10235104 3300025939 Bacteria 1348
676 Ga0207665_10472234 3300025939 Unclassified 965
677 Ga0207691_10000459 3300025940 Bacteria 40352
678 Ga0207691_10545967 3300025940 Unclassified 983
679 Ga0207711_10002757 3300025941 Bacteria 15476
680 Ga0207711_10004283 3300025941 Bacteria 12191
681 Ga0207711_10004875 3300025941 Bacteria 11390
682 Ga0207711_10386704 3300025941 Bacteria 1299
683 Ga0207711_10403708 3300025941 Bacteria 1270
684 Ga0207711_10730866 3300025941 Bacteria 923
685 Ga0207689_10000166 3300025942 Bacteria 57369
686 Ga0207689_10001458 3300025942 Bacteria 22635
687 Ga0207689_10031999 3300025942 Bacteria 4375
688 Ga0207689_10046784 3300025942 Unclassified 3574
689 Ga0207689_10135088 3300025942 Bacteria 2031
690 Ga0207661_10001667 3300025944 Bacteria 15142
691 Ga0207661_10087290 3300025944 Unclassified 2590
692 Ga0207661_10119206 3300025944 Bacteria 2244
693 Ga0207679_10000496 3300025945 Bacteria 27124
694 Ga0207679_10004667 3300025945 Bacteria 8536
695 Ga0207679_10013182 3300025945 Bacteria 5415
696 Ga0207679_10062735 3300025945 Unclassified 2771
697 Ga0207679_10238884 3300025945 Bacteria 1538
698 Ga0207667_10000213 3300025949 Bacteria 81973
699 Ga0207667_10003075 3300025949 Bacteria 20688
700 Ga0207667_10265135 3300025949 Unclassified 1757
701 Ga0207667_10339491 3300025949 Bacteria 1533
702 Ga0207667_10394207 3300025949 Bacteria 1410
703 Ga0207651_10064958 3300025960 Bacteria 2556
704 Ga0207651_10168669 3300025960 Bacteria 1724
705 Ga0207712_10021189 3300025961 Bacteria 4265
706 Ga0207712_10032280 3300025961 Bacteria 3534
707 Ga0207668_10018828 3300025972 Bacteria 4353
708 Ga0207668_10169345 3300025972 Bacteria 1711
709 Ga0207640_10016573 3300025981 Unclassified 4290
710 Ga0207640_10032474 3300025981 Bacteria 3237
711 Ga0207640_10112138 3300025981 Bacteria 1936
712 Ga0207640_10189376 3300025981 Bacteria 1549
713 Ga0207640_10726855 3300025981 Unclassified 854
714 Ga0207658_10147651 3300025986 Bacteria 1911
715 Ga0207658_10187202 3300025986 Bacteria 1718
716 Ga0207658_10673197 3300025986 Unclassified 934
717 Ga0207658_10714698 3300025986 Unclassified 906
718 Ga0207677_10018312 3300026023 Bacteria 4200
719 Ga0207677_10029386 3300026023 Bacteria 3492
720 Ga0207677_10089122 3300026023 Unclassified 2239
721 Ga0207677_10315951 3300026023 Bacteria 1296
722 Ga0207677_10875546 3300026023 Unclassified 808
723 Ga0207703_10005501 3300026035 Bacteria 10182
724 Ga0207703_10048898 3300026035 Bacteria 3416
725 Ga0207703_10225667 3300026035 Bacteria 1677
726 Ga0207703_10572438 3300026035 Unclassified 1066
727 Ga0207703_10628668 3300026035 Unclassified 1017
728 Ga0207639_10034997 3300026041 Bacteria 3716
729 Ga0207639_10052098 3300026041 Bacteria 3117
730 Ga0207639_10206472 3300026041 Bacteria 1688
731 Ga0207639_10766067 3300026041 Bacteria 898
732 Ga0207639_10796705 3300026041 Unclassified 880
733 Ga0207678_10000328 3300026067 Bacteria 42509
734 Ga0207678_10002447 3300026067 Bacteria 16873
735 Ga0207678_10124199 3300026067 Bacteria 2202
736 Ga0207702_10000114 3300026078 Bacteria 93951
737 Ga0207702_10001495 3300026078 Bacteria 23103
738 Ga0207702_10007437 3300026078 Bacteria 9347
739 Ga0207702_10020286 3300026078 Bacteria 5506
740 Ga0207702_10432549 3300026078 Unclassified 1274
741 Ga0207702_10602011 3300026078 Unclassified 1078
742 Ga0207641_10001283 3300026088 Bacteria 25008
743 Ga0207641_10040915 3300026088 Bacteria 3883
744 Ga0207641_10044284 3300026088 Unclassified 3742
745 Ga0207641_10176197 3300026088 Unclassified 1955
746 Ga0207641_10296256 3300026088 Unclassified 1526
747 Ga0207641_10923134 3300026088 Bacteria 867
748 Ga0207648_10000826 3300026089 Bacteria 34905
749 Ga0207648_10059874 3300026089 Bacteria 3321
750 Ga0207648_10066105 3300026089 Bacteria 3153
751 Ga0207648_10755061 3300026089 Bacteria 904
752 Ga0207648_11166450 3300026089 Unclassified 723
753 Ga0207676_10000058 3300026095 Bacteria 120315
754 Ga0207676_10002123 3300026095 Bacteria 14348
755 Ga0207676_10036414 3300026095 Unclassified 3743
756 Ga0207674_10000148 3300026116 Bacteria 82478
757 Ga0207674_10000860 3300026116 Bacteria 39670
758 Ga0207674_10001389 3300026116 Bacteria 31181
759 Ga0207674_10049534 3300026116 Bacteria 4295
760 Ga0207674_10058791 3300026116 Bacteria 3893
761 Ga0207674_10186877 3300026116 Bacteria 2022
762 Ga0207675_100275256 3300026118 Bacteria 1634
763 Ga0207683_10013575 3300026121 Bacteria 6949
764 Ga0207683_10153126 3300026121 Bacteria 2082
765 Ga0207683_10231082 3300026121 Unclassified 1687
766 Ga0207698_10007054 3300026142 Bacteria 7036
767 Ga0207698_10131924 3300026142 Bacteria 2136
768 Ga0207698_10145340 3300026142 Unclassified 2050
769 Ga0207698_10245530 3300026142 Bacteria 1635
770 Ga0207698_10878364 3300026142 Unclassified 903
771 Ga0209588_1140410 3300027671 Bacteria 768
772 Ga0265356_1000040 3300028017 Bacteria 20826
773 Ga0268266_10074822 3300028379 Bacteria 2941
774 Ga0268266_10396620 3300028379 Unclassified 1304
775 Ga0268265_10026162 3300028380 Bacteria 4148
776 Ga0268265_10212363 3300028380 Bacteria 1687
777 Ga0268264_10054667 3300028381 Unclassified 3334
778 Ga0268264_10093906 3300028381 Bacteria 2593
779 Ga0268264_10175561 3300028381 Bacteria 1941
780 Ga0268264_10278252 3300028381 Bacteria 1566
781 Ga0265338_10008016 3300028800 Bacteria 12927
782 Ga0265338_10010465 3300028800 Bacteria 10868
783 Ga0265338_10099047 3300028800 Bacteria 2382
784 Ga0265762_1002743 3300030760 Bacteria 3151
785 Ga0265762_1012728 3300030760 Bacteria 1511
786 Ga0265767_104246 3300030836 Bacteria 833
787 Ga0265770_1002756 3300030878 Bacteria 2385
788 Ga0265760_10000172 3300031090 Bacteria 17165
789 Ga0265760_10006480 3300031090 Bacteria 3347
790 Ga0265760_10008939 3300031090 Bacteria 2861
791 Ga0265760_10012223 3300031090 Unclassified 2453
792 Ga0265760_10071720 3300031090 Bacteria 1063
793 Ga0265325_10021987 3300031241 Bacteria 3498
794 Ga0265325_10072187 3300031241 Bacteria 1731
795 Ga0265339_10124375 3300031249 Unclassified 1323
796 Ga0265316_10197606 3300031344 Bacteria 1492
797 Ga0265314_10002967 3300031711 Bacteria 16812
798 Ga0265314_10022093 3300031711 Bacteria 4878
799 Ga0316214_1002952 3300033545 Unclassified 2119
800 Ga0316214_1025086 3300033545 Unclassified 839
801 Ga0316212_1022695 3300033547 Unclassified 879
802 Ga0373948_0024983 3300034817 Bacteria 1169
803 Ga0373934_0035489 3300035086 Unclassified 1962
804 Ga0373940_0170900 3300035088 Unclassified 702
805 Ga0373944_0075397 3300035089 Unclassified 1106
806 Ga0373923_0044959 3300035111 Unclassified 1833
807 Ga0373932_0039896 3300035112 Bacteria 1349
808 Ga0373936_0004143 3300035113 Bacteria 5466
809 Ga0373936_0068571 3300035113 Unclassified 1458
810 Ga0373936_0084815 3300035113 Unclassified 1322
811 Ga0373941_0165355 3300035115 Unclassified 821
812 Ga0373945_0011201 3300035116 Bacteria 2962
813 Ga0373945_0033738 3300035116 Bacteria 1821
814 Ga0373945_0149661 3300035116 Unclassified 945
815 Ga0373953_0018713 3300035117 Bacteria 2567
816 Ga0373954_0038167 3300035118 Unclassified 2233
817 Ga0373957_0063596 3300035120 Unclassified 1433
818 Ga0373943_0003361 3300035170 Bacteria 7269
819 Ga0373943_0119556 3300035170 Unclassified 1399
820 Ga0373943_0336782 3300035170 Bacteria 862
821 Ga0373943_0491519 3300035170 Unclassified 716
822 Ga0373946_0027897 3300035171 Bacteria 2236
823 Ga0373946_0115928 3300035171 Unclassified 1218
824 Ga0373955_0044316 3300035172 Bacteria 2395
825 Ga0373955_0179627 3300035172 Unclassified 1255
826 Ga0373942_0083517 3300035207 Unclassified 952
827 Ga0373924_0008187 3300035410 Unclassified 3791
828 Ga0373931_0224926 3300035691 Unclassified 1131
829 Ga0373935_0010998 3300035692 Bacteria 5436
830 Ga0373935_0024085 3300035692 Bacteria 3744
831 Ga0373935_0042141 3300035692 Bacteria 2870
832 Ga0373935_0088933 3300035692 Unclassified 2019
833 Ga0373927_0000097 3300035695 Bacteria 66228
834 Ga0373927_0009726 3300035695 Bacteria 6445
835 Ga0373927_0066421 3300035695 Bacteria 2333
836 Ga0373927_0101974 3300035695 Unclassified 1867
837 Ga0373927_0235915 3300035695 Unclassified 1202
838 Ga0373933_0008807 3300035724 Bacteria 5501
839 Ga0373933_0039974 3300035724 Unclassified 2761
840 Ga0373933_0175895 3300035724 Unclassified 1364
841 Ga0373933_0331108 3300035724 Unclassified 988
842 Ga0373933_0413017 3300035724 Unclassified 881
843 Ga0373933_0517863 3300035724 Unclassified 782
844 Ga0373947_0000273 3300035725 Bacteria 29358
845 Ga0373947_0004931 3300035725 Bacteria 7805
846 Ga0373947_0103524 3300035725 Bacteria 1792
847 Ga0373937_0019513 3300036401 Bacteria 6066
848 Ga0373937_0023853 3300036401 Bacteria 5516
849 Ga0373937_0057487 3300036401 Unclassified 3573
850 Ga0373937_0064885 3300036401 Unclassified 3360
851 Ga0373937_0102846 3300036401 Bacteria 2652
852 Ga0373937_0430781 3300036401 Unclassified 1252
853 Ga0373937_0519497 3300036401 Unclassified 1131
854 Ga0373925_0003931 3300037068 Bacteria 11347
855 Ga0373925_0007055 3300037068 Bacteria 8209
856 Ga0373925_0014525 3300037068 Bacteria 5691
857 Ga0373925_0079427 3300037068 Bacteria 2493
858 Ga0373925_0167640 3300037068 Unclassified 1732
859 Ga0373925_0168463 3300037068 Unclassified 1728
860 Ga0436364_1110329 3300037853 Bacteria 2446
861 Ga0436360_0028730 3300039438 Bacteria 2384
862 Ga0436362_1017484 3300039453 Bacteria 4646
863 Ga0466965_0088475 3300044683 Unclassified 1573
864 Ga0466961_0140333 3300044693 Unclassified 1513
865 Ga0466963_0139862 3300044694 Unclassified 1676
866 Ga0466964_0350797 3300044706 Bacteria 758
867 Ga0453684_0312454 3300044712 Bacteria 1783
868 Ga0466971_0084679 3300044719 Unclassified 1448
869 Ga0466957_0222445 3300044842 Unclassified 1247
870 Ga0466959_0440776 3300045049 Unclassified 883
871 Ga0451576_0613687 3300045051 Bacteria 1143
872 Ga0451576_0987032 3300045051 Bacteria 883
873 Ga0451576_1280470 3300045051 Unclassified 764
874 Ga0466958_0247231 3300045836 Unclassified 1140
875 Ga0466967_0069816 3300045976 Bacteria 3141
876 Ga0466967_0446093 3300045976 Bacteria 1264
877 Ga0495629_0062294 3300046459 Unclassified 2606
878 Ga0495653_0402536 3300046463 Unclassified 870
879 Ga0495580_0000068 3300046472 Bacteria 63122
880 Ga0495580_0000390 3300046472 Bacteria 35923
881 Ga0495580_0000632 3300046472 Bacteria 29798
882 Ga0495580_0003018 3300046472 Bacteria 14420
883 Ga0495580_0038873 3300046472 Unclassified 3405
884 Ga0495580_0047143 3300046472 Bacteria 3056
885 Ga0495580_0048399 3300046472 Unclassified 3010
886 Ga0495580_0182290 3300046472 Bacteria 1450
887 Ga0495580_0182775 3300046472 Bacteria 1448
888 Ga0495580_0283368 3300046472 Unclassified 1130
889 Ga0495580_0292271 3300046472 Bacteria 1111
890 Ga0495582_0000291 3300046473 Bacteria 27648
891 Ga0495582_0116590 3300046473 Unclassified 1502
892 Ga0495662_0178004 3300046476 Unclassified 1048
893 Ga0495664_0042440 3300046477 Unclassified 2694
894 Ga0495628_0170727 3300046516 Bacteria 1649
895 Ga0495628_0251890 3300046516 Unclassified 1318
896 Ga0495630_0032613 3300046517 Unclassified 3883
897 Ga0495630_0112947 3300046517 Bacteria 2058
898 Ga0495630_0572127 3300046517 Unclassified 866
899 Ga0495630_0773224 3300046517 Unclassified 734
900 Ga0495666_0046554 3300046526 Bacteria 2091
901 Ga0495652_0183427 3300046529 Bacteria 1604
902 Ga0495665_0026314 3300046531 Unclassified 3124
903 Ga0495665_0129909 3300046531 Bacteria 1319
904 Ga0495665_0266268 3300046531 Unclassified 881
905 Ga0495586_0202657 3300046535 Unclassified 1125
906 Ga0495587_0085692 3300046536 Unclassified 1824
907 Ga0495645_0063479 3300046543 Bacteria 2674
908 Ga0495634_0448689 3300046642 Unclassified 761
909 Ga0495659_0134217 3300046664 Bacteria 983
910 Ga0495599_0206136 3300046678 Bacteria 1207
911 Ga0495658_0008453 3300046683 Bacteria 5101
912 Ga0495658_0527980 3300046683 Bacteria 755
913 Ga0495613_0262864 3300046689 Unclassified 1202
914 Ga0495670_0112837 3300046691 Unclassified 1408
915 Ga0495581_0435666 3300047315 Unclassified 764
916 Ga0495604_0329445 3300047317 Unclassified 1019
917 Ga0495674_0016019 3300047319 Bacteria 6996
918 Ga0495674_0103640 3300047319 Bacteria 2419
919 Ga0495674_0139553 3300047319 Unclassified 2038
920 Ga0495674_0337862 3300047319 Unclassified 1224
921 Ga0495674_0648838 3300047319 Unclassified 832
922 Ga0495676_0198784 3300047321 Unclassified 1394
923 Ga0495676_0426488 3300047321 Unclassified 877
924 Ga0495675_0058923 3300047444 Bacteria 2435
925 Ga0495684_0501770 3300047471 Bacteria 834
926 Ga0495602_0095210 3300048088 Bacteria 2459
927 Ga0495602_0305789 3300048088 Unclassified 1162
928 Ga0496100_0119274 3300048903 Bacteria 1843
929 Ga0496100_0233714 3300048903 Bacteria 1354
930 Ga0496100_0344815 3300048903 Bacteria 1124
931 Ga0496100_0488136 3300048903 Bacteria 948
932 Ga0496100_0937622 3300048903 Unclassified 680
933 Ga0496101_0038805 3300048904 Bacteria 3384
934 Ga0496101_0117394 3300048904 Bacteria 2009
935 Ga0496101_0309521 3300048904 Bacteria 1238
936 Ga0496101_0450630 3300048904 Bacteria 1015
937 Ga0496102_0010132 3300048905 Bacteria 8106
938 Ga0496102_0046899 3300048905 Bacteria 3925
939 Ga0496102_0053318 3300048905 Bacteria 3687
940 Ga0496102_0194099 3300048905 Bacteria 1914
941 Ga0496102_0340715 3300048905 Unclassified 1412
942 Ga0496102_0396889 3300048905 Bacteria 1297
943 Ga0496102_0412569 3300048905 Unclassified 1269
944 Ga0496103_0003667 3300048906 Bacteria 9348
945 Ga0496103_0114317 3300048906 Unclassified 1716
946 Ga0496104_0064252 3300048907 Unclassified 3482
947 Ga0496104_0065831 3300048907 Bacteria 3440
948 Ga0496104_0093388 3300048907 Bacteria 2878
949 Ga0496104_0148251 3300048907 Bacteria 2253
950 Ga0496104_0230735 3300048907 Bacteria 1763
951 Ga0496104_0572586 3300048907 Unclassified 1040
952 Ga0496105_0219216 3300048908 Unclassified 1549
953 Ga0496105_0265041 3300048908 Unclassified 1389
954 Ga0496105_0275814 3300048908 Bacteria 1357
955 Ga0496106_0031873 3300048909 Bacteria 3928
956 Ga0496106_0089262 3300048909 Bacteria 2377
957 Ga0496106_0104752 3300048909 Bacteria 2197
958 Ga0496106_0359074 3300048909 Bacteria 1170
959 Ga0496106_0372534 3300048909 Unclassified 1147
960 Ga0496107_0025905 3300048910 Bacteria 4156
961 Ga0496107_0108449 3300048910 Bacteria 2039
962 Ga0496108_0000170 3300048911 Bacteria 61234
963 Ga0496108_0039842 3300048911 Bacteria 3916
964 Ga0496108_0284098 3300048911 Bacteria 1440
965 Ga0496108_0346063 3300048911 Bacteria 1297
966 Ga0496108_0412356 3300048911 Unclassified 1180
967 Ga0496109_0000621 3300048912 Bacteria 29592
968 Ga0496109_0055729 3300048912 Bacteria 3606
969 Ga0496109_0522454 3300048912 Unclassified 1120
970 Ga0496110_0019980 3300048913 Bacteria 5646
971 Ga0496110_0392830 3300048913 Bacteria 1264
972 Ga0496110_0734514 3300048913 Bacteria 890
973 Ga0496111_0002648 3300048914 Bacteria 10857
974 Ga0496111_0371204 3300048914 Bacteria 1058
975 Ga0496112_0000152 3300048915 Bacteria 43283
976 Ga0496112_0001076 3300048915 Bacteria 20196
977 Ga0496112_0010933 3300048915 Bacteria 8264
978 Ga0496112_0011133 3300048915 Bacteria 8201
979 Ga0496112_0218716 3300048915 Unclassified 1861
980 Ga0496112_0534070 3300048915 Unclassified 1107
981 Ga0496112_0749567 3300048915 Bacteria 903
982 Ga0496112_0885368 3300048915 Unclassified 815
983 Ga0496113_0018313 3300048916 Unclassified 4875
984 Ga0496113_0053888 3300048916 Unclassified 3008
985 Ga0496113_0133330 3300048916 Bacteria 1951
986 Ga0496113_0418134 3300048916 Bacteria 1077
987 Ga0496114_0024403 3300048917 Bacteria 4936
988 Ga0496114_0056277 3300048917 Bacteria 3282
989 Ga0496115_0012647 3300048918 Bacteria 6360
990 Ga0496115_0043711 3300048918 Bacteria 3573
991 Ga0496115_0224682 3300048918 Unclassified 1549
992 Ga0496115_0344194 3300048918 Unclassified 1216
993 Ga0495682_0174605 3300049460 Unclassified 764
994 Ga0501073_0514696 3300049589 Unclassified 827
995 Ga0501083_0285583 3300049744 Unclassified 1073
996 nmdc:mga0n895_1163_c1 3300050512 Bacteria 19263
997 nmdc:mga0n895_1999_c1 3300050512 Bacteria 15655
998 nmdc:mga0n895_404245_c1 3300050512 Bacteria 1381
999 nmdc:mga0n895_819076_c1 3300050512 Unclassified 920
1000 nmdc:mga0rr50_457197_c1 3300050513 Unclassified 1083
1001 nmdc:mga08x19_103183_c1 3300050514 Bacteria 1894
1002 nmdc:mga08x19_3802_c1 3300050514 Bacteria 7105
1003 nmdc:mga08x19_859_c1 3300050514 Bacteria 19283
1004 nmdc:mga0a205_164152_c1 3300050515 Unclassified 2117
1005 nmdc:mga0a205_25343_c1 3300050515 Bacteria 5650
1006 Ga0495601_0057857 3300053077 Bacteria 2456
1007 Ga0495612_0044444 3300053078 Unclassified 1818
1008 Ga0495612_0098517 3300053078 Bacteria 1243
1009 Ga0495612_0171175 3300053078 Unclassified 951
1010 Ga0495612_0250525 3300053078 Unclassified 788
1011 Ga0495619_0190933 3300053085 Unclassified 1418
1012 Ga0495619_0300298 3300053085 Unclassified 1112
1013 Ga0501084_0399363 3300054114 Unclassified 1162
1014 Ga0587084_046567 3300059477 Unclassified 755
1015 Ga0587066_010893 3300059490 Bacteria 1322
1016 Ga0587083_0014262 3300059505 Bacteria 1366
1017 Ga0587083_0033283 3300059505 Unclassified 1039
1018 Ga0587076_043898 3300059645 Unclassified 846

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031090 Ga0265760_10012223 Ga0265760_100122232 153
2 3300005434 Ga0070709_10023873 Ga0070709_100238733 164
3 3300025906 Ga0207699_10027939 Ga0207699_100279393 164
4 3300025928 Ga0207700_10117120 Ga0207700_101171202 164
5 3300028800 Ga0265338_10010465 Ga0265338_100104657 165
6 3300031249 Ga0265339_10124375 Ga0265339_101243752 165
7 3300030836 Ga0265767_104246 Ga0265767_1042462 166
8 3300033545 Ga0316214_1002952 Ga0316214_10029523 166
9 3300013104 Ga0157370_10297528 Ga0157370_102975282 176
10 3300005468 Ga0070707_100300742 Ga0070707_1003007422 182
11 3300025914 Ga0207671_10851151 Ga0207671_108511511 183
12 3300004801 Ga0058860_11978086 Ga0058860_119780862 184
13 3300005334 Ga0068869_100038435 Ga0068869_1000384354 184
14 3300005338 Ga0068868_100083073 Ga0068868_1000830732 184
15 3300005340 Ga0070689_100438618 Ga0070689_1004386181 184
16 3300005344 Ga0070661_100433625 Ga0070661_1004336252 184
17 3300005354 Ga0070675_100403856 Ga0070675_1004038562 184
18 3300005367 Ga0070667_100744516 Ga0070667_1007445161 184
19 3300005445 Ga0070708_100005568 Ga0070708_10000556810 184
20 3300005539 Ga0068853_100077536 Ga0068853_1000775364 184
21 3300005563 Ga0068855_100222675 Ga0068855_1002226751 184
22 3300005718 Ga0068866_10021829 Ga0068866_100218294 184
23 3300005841 Ga0068863_100038509 Ga0068863_1000385092 184
24 3300005842 Ga0068858_100702272 Ga0068858_1007022722 184
25 3300005843 Ga0068860_100024585 Ga0068860_1000245856 184
26 3300005844 Ga0068862_100154125 Ga0068862_1001541253 184
27 3300005983 Ga0081540_1060056 Ga0081540_10600562 184
28 3300005983 Ga0081540_1079668 Ga0081540_10796682 184
29 3300006028 Ga0070717_10016710 Ga0070717_100167108 184
30 3300006173 Ga0070716_100291271 Ga0070716_1002912712 184
31 3300006237 Ga0097621_100131172 Ga0097621_1001311722 184
32 3300006881 Ga0068865_100008049 Ga0068865_1000080492 184
33 3300009101 Ga0105247_10766230 Ga0105247_107662301 184
34 3300009176 Ga0105242_11054714 Ga0105242_110547142 184
35 3300009177 Ga0105248_10168518 Ga0105248_101685183 184
36 3300009545 Ga0105237_11498039 Ga0105237_114980391 184
37 3300010375 Ga0105239_10009528 Ga0105239_100095281 184
38 3300013102 Ga0157371_10405826 Ga0157371_104058262 184
39 3300013296 Ga0157374_10007625 Ga0157374_100076257 184
40 3300013306 Ga0163162_10018901 Ga0163162_100189016 184
41 3300013308 Ga0157375_10100161 Ga0157375_101001612 184
42 3300014968 Ga0157379_10117922 Ga0157379_101179223 184
43 3300014969 Ga0157376_10257624 Ga0157376_102576242 184
44 3300015265 Ga0182005_1038296 Ga0182005_10382962 184
45 3300025899 Ga0207642_10110717 Ga0207642_101107172 184
46 3300025904 Ga0207647_10006770 Ga0207647_100067707 184
47 3300025914 Ga0207671_10641769 Ga0207671_106417691 184
48 3300025934 Ga0207686_10432009 Ga0207686_104320092 184
49 3300025938 Ga0207704_10006939 Ga0207704_100069396 184
50 3300025939 Ga0207665_10235104 Ga0207665_102351042 184
51 3300025942 Ga0207689_10000166 Ga0207689_100001662 184
52 3300025986 Ga0207658_10673197 Ga0207658_106731972 184
53 3300026023 Ga0207677_10315951 Ga0207677_103159512 184
54 3300026035 Ga0207703_10005501 Ga0207703_100055013 184
55 3300026035 Ga0207703_10572438 Ga0207703_105724382 184
56 3300026041 Ga0207639_10796705 Ga0207639_107967051 184
57 3300026088 Ga0207641_10040915 Ga0207641_100409156 184
58 3300026088 Ga0207641_10176197 Ga0207641_101761971 184
59 3300026142 Ga0207698_10245530 Ga0207698_102455302 184
60 3300045051 Ga0451576_0987032 Ga0451576_0987032_179_736 184
61 3300046691 Ga0495670_0112837 Ga0495670_0112837_279_836 184
62 3300048915 Ga0496112_0001076 Ga0496112_0001076_16787_17344 184
63 3300049460 Ga0495682_0174605 Ga0495682_0174605_67_624 184
64 3300059477 Ga0587084_046567 Ga0587084_046567_162_719 184
65 3300059645 Ga0587076_043898 Ga0587076_043898_43_600 184
66 3300004799 Ga0058863_11541540 Ga0058863_115415402 185
67 3300004800 Ga0058861_11967417 Ga0058861_119674172 185
68 3300004803 Ga0058862_12820738 Ga0058862_128207381 185
69 3300005328 Ga0070676_10105639 Ga0070676_101056392 185
70 3300005329 Ga0070683_100056407 Ga0070683_1000564075 185
71 3300005329 Ga0070683_100109583 Ga0070683_1001095831 185
72 3300005330 Ga0070690_100149109 Ga0070690_1001491092 185
73 3300005331 Ga0070670_100008946 Ga0070670_1000089467 185
74 3300005334 Ga0068869_100029232 Ga0068869_1000292323 185
75 3300005336 Ga0070680_100106362 Ga0070680_1001063622 185
76 3300005338 Ga0068868_100037844 Ga0068868_1000378443 185
77 3300005338 Ga0068868_100057200 Ga0068868_1000572006 185
78 3300005341 Ga0070691_10107415 Ga0070691_101074152 185
79 3300005344 Ga0070661_100546227 Ga0070661_1005462271 185
80 3300005364 Ga0070673_100042242 Ga0070673_1000422422 185
81 3300005366 Ga0070659_100700216 Ga0070659_1007002162 185
82 3300005434 Ga0070709_10508767 Ga0070709_105087671 185
83 3300005435 Ga0070714_100000801 Ga0070714_1000008015 185
84 3300005435 Ga0070714_100097891 Ga0070714_1000978911 185
85 3300005435 Ga0070714_100244840 Ga0070714_1002448402 185
86 3300005435 Ga0070714_100257715 Ga0070714_1002577152 185
87 3300005435 Ga0070714_100448607 Ga0070714_1004486072 185
88 3300005436 Ga0070713_100164175 Ga0070713_1001641752 185
89 3300005436 Ga0070713_100168656 Ga0070713_1001686562 185
90 3300005436 Ga0070713_100329561 Ga0070713_1003295612 185
91 3300005436 Ga0070713_100917487 Ga0070713_1009174871 185
92 3300005437 Ga0070710_10021673 Ga0070710_100216732 185
93 3300005437 Ga0070710_10082745 Ga0070710_100827452 185
94 3300005437 Ga0070710_10262749 Ga0070710_102627492 185
95 3300005439 Ga0070711_100030092 Ga0070711_1000300923 185
96 3300005439 Ga0070711_100174826 Ga0070711_1001748262 185
97 3300005440 Ga0070705_100067854 Ga0070705_1000678542 185
98 3300005457 Ga0070662_100606752 Ga0070662_1006067522 185
99 3300005458 Ga0070681_10000026 Ga0070681_1000002670 185
100 3300005458 Ga0070681_10003878 Ga0070681_100038789 185
101 3300005459 Ga0068867_100026637 Ga0068867_1000266373 185
102 3300005468 Ga0070707_100053245 Ga0070707_1000532452 185
103 3300005530 Ga0070679_100028646 Ga0070679_1000286461 185
104 3300005530 Ga0070679_100051762 Ga0070679_1000517622 185
105 3300005535 Ga0070684_100069961 Ga0070684_1000699614 185
106 3300005535 Ga0070684_100121704 Ga0070684_1001217043 185
107 3300005539 Ga0068853_100006912 Ga0068853_1000069126 185
108 3300005539 Ga0068853_100064187 Ga0068853_1000641873 185
109 3300005539 Ga0068853_100317779 Ga0068853_1003177792 185
110 3300005543 Ga0070672_100572206 Ga0070672_1005722062 185
111 3300005547 Ga0070693_100072316 Ga0070693_1000723163 185
112 3300005563 Ga0068855_100000295 Ga0068855_10000029525 185
113 3300005563 Ga0068855_100043827 Ga0068855_1000438276 185
114 3300005563 Ga0068855_100054917 Ga0068855_1000549172 185
115 3300005563 Ga0068855_100139353 Ga0068855_1001393531 185
116 3300005563 Ga0068855_100373419 Ga0068855_1003734192 185
117 3300005564 Ga0070664_100000687 Ga0070664_10000068719 185
118 3300005577 Ga0068857_100001872 Ga0068857_10000187214 185
119 3300005577 Ga0068857_100010663 Ga0068857_1000106638 185
120 3300005578 Ga0068854_100023329 Ga0068854_1000233295 185
121 3300005578 Ga0068854_100028511 Ga0068854_1000285116 185
122 3300005578 Ga0068854_100050952 Ga0068854_1000509523 185
123 3300005578 Ga0068854_100754427 Ga0068854_1007544271 185
124 3300005614 Ga0068856_100000407 Ga0068856_10000040716 185
125 3300005614 Ga0068856_100000574 Ga0068856_1000005741 185
126 3300005614 Ga0068856_100002064 Ga0068856_1000020643 185
127 3300005614 Ga0068856_100006032 Ga0068856_1000060329 185
128 3300005614 Ga0068856_100009749 Ga0068856_1000097494 185
129 3300005614 Ga0068856_100193997 Ga0068856_1001939972 185
130 3300005616 Ga0068852_100007670 Ga0068852_1000076706 185
131 3300005616 Ga0068852_100097203 Ga0068852_1000972031 185
132 3300005616 Ga0068852_100163911 Ga0068852_1001639112 185
133 3300005616 Ga0068852_100528851 Ga0068852_1005288512 185
134 3300005617 Ga0068859_100039953 Ga0068859_1000399533 185
135 3300005618 Ga0068864_100000684 Ga0068864_10000068427 185
136 3300005618 Ga0068864_100079900 Ga0068864_1000799002 185
137 3300005718 Ga0068866_10022138 Ga0068866_100221382 185
138 3300005840 Ga0068870_10037683 Ga0068870_100376832 185
139 3300005841 Ga0068863_100012509 Ga0068863_1000125094 185
140 3300005841 Ga0068863_100186987 Ga0068863_1001869872 185
141 3300005842 Ga0068858_100003346 Ga0068858_1000033465 185
142 3300005842 Ga0068858_100197436 Ga0068858_1001974362 185
143 3300005843 Ga0068860_100035179 Ga0068860_1000351792 185
144 3300006028 Ga0070717_10191634 Ga0070717_101916343 185
145 3300006028 Ga0070717_10202152 Ga0070717_102021523 185
146 3300006028 Ga0070717_10473219 Ga0070717_104732192 185
147 3300006173 Ga0070716_100009551 Ga0070716_1000095517 185
148 3300006173 Ga0070716_100040899 Ga0070716_1000408992 185
149 3300006175 Ga0070712_100001820 Ga0070712_10000182011 185
150 3300006175 Ga0070712_100089564 Ga0070712_1000895643 185
151 3300006237 Ga0097621_100000237 Ga0097621_10000023717 185
152 3300006237 Ga0097621_100078861 Ga0097621_1000788611 185
153 3300006358 Ga0068871_100001254 Ga0068871_10000125416 185
154 3300006358 Ga0068871_100003099 Ga0068871_1000030995 185
155 3300006358 Ga0068871_100017377 Ga0068871_1000173773 185
156 3300006881 Ga0068865_100024968 Ga0068865_1000249685 185
157 3300006914 Ga0075436_100002468 Ga0075436_1000024689 185
158 3300006931 Ga0097620_100039953 Ga0097620_1000399534 185
159 3300007076 Ga0075435_100052825 Ga0075435_1000528252 185
160 3300009093 Ga0105240_10007038 Ga0105240_100070385 185
161 3300009093 Ga0105240_10063883 Ga0105240_100638832 185
162 3300009093 Ga0105240_10078754 Ga0105240_100787542 185
163 3300009093 Ga0105240_11125776 Ga0105240_111257761 185
164 3300009098 Ga0105245_10322498 Ga0105245_103224982 185
165 3300009148 Ga0105243_10295434 Ga0105243_102954342 185
166 3300009174 Ga0105241_10000910 Ga0105241_1000091017 185
167 3300009174 Ga0105241_10034557 Ga0105241_100345573 185
168 3300009174 Ga0105241_10086055 Ga0105241_100860553 185
169 3300009174 Ga0105241_10122990 Ga0105241_101229902 185
170 3300009174 Ga0105241_10429685 Ga0105241_104296852 185
171 3300009177 Ga0105248_10013380 Ga0105248_100133806 185
172 3300009177 Ga0105248_10077736 Ga0105248_100777363 185
173 3300009177 Ga0105248_10344950 Ga0105248_103449501 185
174 3300009545 Ga0105237_10022977 Ga0105237_100229773 185
175 3300009545 Ga0105237_11027503 Ga0105237_110275031 185
176 3300009551 Ga0105238_10000188 Ga0105238_100001881 185
177 3300009551 Ga0105238_10016920 Ga0105238_100169204 185
178 3300010375 Ga0105239_10059067 Ga0105239_100590676 185
179 3300013100 Ga0157373_10001291 Ga0157373_100012919 185
180 3300013100 Ga0157373_10106830 Ga0157373_101068302 185
181 3300013100 Ga0157373_10135455 Ga0157373_101354552 185
182 3300013102 Ga0157371_10603082 Ga0157371_106030821 185
183 3300013104 Ga0157370_10011537 Ga0157370_100115373 185
184 3300013104 Ga0157370_10025983 Ga0157370_100259835 185
185 3300013105 Ga0157369_10000124 Ga0157369_1000012476 185
186 3300013105 Ga0157369_10013546 Ga0157369_100135462 185
187 3300013105 Ga0157369_10026095 Ga0157369_100260952 185
188 3300013105 Ga0157369_10059396 Ga0157369_100593963 185
189 3300013105 Ga0157369_10115306 Ga0157369_101153064 185
190 3300013296 Ga0157374_10000162 Ga0157374_1000016220 185
191 3300013296 Ga0157374_10000582 Ga0157374_100005821 185
192 3300013296 Ga0157374_10002038 Ga0157374_1000203816 185
193 3300013296 Ga0157374_10053221 Ga0157374_100532213 185
194 3300013296 Ga0157374_11442313 Ga0157374_114423131 185
195 3300013297 Ga0157378_10000020 Ga0157378_1000002054 185
196 3300013297 Ga0157378_10000320 Ga0157378_1000032016 185
197 3300013297 Ga0157378_10003732 Ga0157378_100037327 185
198 3300013307 Ga0157372_10000084 Ga0157372_1000008461 185
199 3300013307 Ga0157372_10001092 Ga0157372_1000109226 185
200 3300013307 Ga0157372_10001112 Ga0157372_100011124 185
201 3300013307 Ga0157372_10007677 Ga0157372_100076775 185
202 3300013307 Ga0157372_10030884 Ga0157372_100308842 185
203 3300013307 Ga0157372_10035192 Ga0157372_100351927 185
204 3300013307 Ga0157372_10055764 Ga0157372_100557644 185
205 3300013307 Ga0157372_10212864 Ga0157372_102128643 185
206 3300013307 Ga0157372_10340278 Ga0157372_103402782 185
207 3300013307 Ga0157372_10429140 Ga0157372_104291402 185
208 3300014969 Ga0157376_10001784 Ga0157376_1000178412 185
209 3300014969 Ga0157376_10001794 Ga0157376_100017941 185
210 3300020080 Ga0206350_11157382 Ga0206350_111573825 185
211 3300021377 Ga0213874_10071993 Ga0213874_100719932 185
212 3300022467 Ga0224712_10097972 Ga0224712_100979721 185
213 3300025898 Ga0207692_10076629 Ga0207692_100766293 185
214 3300025898 Ga0207692_10102483 Ga0207692_101024833 185
215 3300025898 Ga0207692_10303501 Ga0207692_103035012 185
216 3300025899 Ga0207642_10014085 Ga0207642_100140853 185
217 3300025904 Ga0207647_10031767 Ga0207647_100317672 185
218 3300025906 Ga0207699_10015704 Ga0207699_100157045 185
219 3300025906 Ga0207699_10491468 Ga0207699_104914682 185
220 3300025908 Ga0207643_10157106 Ga0207643_101571061 185
221 3300025911 Ga0207654_10036475 Ga0207654_100364752 185
222 3300025911 Ga0207654_10069633 Ga0207654_100696332 185
223 3300025911 Ga0207654_10317364 Ga0207654_103173642 185
224 3300025911 Ga0207654_10535023 Ga0207654_105350232 185
225 3300025912 Ga0207707_10000800 Ga0207707_1000080015 185
226 3300025912 Ga0207707_10008961 Ga0207707_100089618 185
227 3300025912 Ga0207707_10064483 Ga0207707_100644831 185
228 3300025913 Ga0207695_10018259 Ga0207695_100182597 185
229 3300025913 Ga0207695_10028234 Ga0207695_100282342 185
230 3300025913 Ga0207695_10049830 Ga0207695_100498307 185
231 3300025913 Ga0207695_10206897 Ga0207695_102068973 185
232 3300025913 Ga0207695_10475059 Ga0207695_104750592 185
233 3300025914 Ga0207671_10246618 Ga0207671_102466182 185
234 3300025914 Ga0207671_10522239 Ga0207671_105222391 185
235 3300025915 Ga0207693_10008124 Ga0207693_100081243 185
236 3300025915 Ga0207693_10015084 Ga0207693_100150845 185
237 3300025916 Ga0207663_10009352 Ga0207663_100093523 185
238 3300025916 Ga0207663_10365848 Ga0207663_103658482 185
239 3300025917 Ga0207660_10019266 Ga0207660_100192666 185
240 3300025917 Ga0207660_10432805 Ga0207660_104328052 185
241 3300025920 Ga0207649_10551739 Ga0207649_105517391 185
242 3300025921 Ga0207652_10052324 Ga0207652_100523242 185
243 3300025921 Ga0207652_10253362 Ga0207652_102533623 185
244 3300025924 Ga0207694_10000434 Ga0207694_1000043435 185
245 3300025925 Ga0207650_10045927 Ga0207650_100459273 185
246 3300025927 Ga0207687_10315703 Ga0207687_103157032 185
247 3300025928 Ga0207700_10008553 Ga0207700_100085537 185
248 3300025928 Ga0207700_10009126 Ga0207700_100091263 185
249 3300025928 Ga0207700_10083494 Ga0207700_100834943 185
250 3300025928 Ga0207700_10115398 Ga0207700_101153982 185
251 3300025928 Ga0207700_10276955 Ga0207700_102769552 185
252 3300025928 Ga0207700_10742627 Ga0207700_107426272 185
253 3300025929 Ga0207664_10013520 Ga0207664_100135207 185
254 3300025929 Ga0207664_10242000 Ga0207664_102420002 185
255 3300025929 Ga0207664_10566030 Ga0207664_105660302 185
256 3300025929 Ga0207664_11210940 Ga0207664_112109401 185
257 3300025932 Ga0207690_10253114 Ga0207690_102531142 185
258 3300025933 Ga0207706_10097987 Ga0207706_100979872 185
259 3300025935 Ga0207709_10187376 Ga0207709_101873762 185
260 3300025938 Ga0207704_10085128 Ga0207704_100851282 185
261 3300025939 Ga0207665_10030987 Ga0207665_100309875 185
262 3300025939 Ga0207665_10214247 Ga0207665_102142472 185
263 3300025940 Ga0207691_10545967 Ga0207691_105459671 185
264 3300025941 Ga0207711_10004283 Ga0207711_100042838 185
265 3300025941 Ga0207711_10386704 Ga0207711_103867042 185
266 3300025941 Ga0207711_10730866 Ga0207711_107308662 185
267 3300025942 Ga0207689_10046784 Ga0207689_100467842 185
268 3300025944 Ga0207661_10087290 Ga0207661_100872902 185
269 3300025944 Ga0207661_10119206 Ga0207661_101192061 185
270 3300025945 Ga0207679_10004667 Ga0207679_100046675 185
271 3300025945 Ga0207679_10062735 Ga0207679_100627353 185
272 3300025949 Ga0207667_10000213 Ga0207667_1000021312 185
273 3300025949 Ga0207667_10003075 Ga0207667_100030753 185
274 3300025949 Ga0207667_10265135 Ga0207667_102651352 185
275 3300025949 Ga0207667_10394207 Ga0207667_103942071 185
276 3300025960 Ga0207651_10168669 Ga0207651_101686692 185
277 3300025981 Ga0207640_10016573 Ga0207640_100165735 185
278 3300025981 Ga0207640_10032474 Ga0207640_100324742 185
279 3300025981 Ga0207640_10726855 Ga0207640_107268551 185
280 3300026023 Ga0207677_10089122 Ga0207677_100891223 185
281 3300026023 Ga0207677_10875546 Ga0207677_108755462 185
282 3300026035 Ga0207703_10225667 Ga0207703_102256672 185
283 3300026035 Ga0207703_10628668 Ga0207703_106286682 185
284 3300026041 Ga0207639_10034997 Ga0207639_100349973 185
285 3300026041 Ga0207639_10052098 Ga0207639_100520982 185
286 3300026041 Ga0207639_10766067 Ga0207639_107660671 185
287 3300026078 Ga0207702_10000114 Ga0207702_1000011424 185
288 3300026078 Ga0207702_10001495 Ga0207702_100014954 185
289 3300026078 Ga0207702_10007437 Ga0207702_100074374 185
290 3300026088 Ga0207641_10044284 Ga0207641_100442843 185
291 3300026089 Ga0207648_10059874 Ga0207648_100598743 185
292 3300026089 Ga0207648_11166450 Ga0207648_111664501 185
293 3300026095 Ga0207676_10002123 Ga0207676_100021235 185
294 3300026095 Ga0207676_10036414 Ga0207676_100364143 185
295 3300026116 Ga0207674_10000860 Ga0207674_100008605 185
296 3300026116 Ga0207674_10001389 Ga0207674_1000138928 185
297 3300026121 Ga0207683_10231082 Ga0207683_102310822 185
298 3300026142 Ga0207698_10007054 Ga0207698_100070544 185
299 3300026142 Ga0207698_10145340 Ga0207698_101453403 185
300 3300026142 Ga0207698_10878364 Ga0207698_108783642 185
301 3300028381 Ga0268264_10054667 Ga0268264_100546672 185
302 3300035111 Ga0373923_0044959 Ga0373923_0044959_832_1401 185
303 3300035113 Ga0373936_0004143 Ga0373936_0004143_190_759 185
304 3300035116 Ga0373945_0033738 Ga0373945_0033738_479_1048 185
305 3300035170 Ga0373943_0336782 Ga0373943_0336782_123_719 185
306 3300035170 Ga0373943_0491519 Ga0373943_0491519_62_631 185
307 3300035171 Ga0373946_0027897 Ga0373946_0027897_842_1411 185
308 3300035207 Ga0373942_0083517 Ga0373942_0083517_143_739 185
309 3300035691 Ga0373931_0224926 Ga0373931_0224926_59_655 185
310 3300035692 Ga0373935_0042141 Ga0373935_0042141_813_1382 185
311 3300035692 Ga0373935_0088933 Ga0373935_0088933_1313_1882 185
312 3300035695 Ga0373927_0009726 Ga0373927_0009726_916_1485 185
313 3300035695 Ga0373927_0066421 Ga0373927_0066421_1392_1988 185
314 3300035724 Ga0373933_0039974 Ga0373933_0039974_1049_1618 185
315 3300035724 Ga0373933_0413017 Ga0373933_0413017_70_666 185
316 3300035725 Ga0373947_0004931 Ga0373947_0004931_2550_3119 185
317 3300036401 Ga0373937_0019513 Ga0373937_0019513_478_1074 185
318 3300036401 Ga0373937_0064885 Ga0373937_0064885_1430_1999 185
319 3300037068 Ga0373925_0003931 Ga0373925_0003931_1652_2248 185
320 3300037068 Ga0373925_0014525 Ga0373925_0014525_4016_4585 185
321 3300037068 Ga0373925_0079427 Ga0373925_0079427_285_854 185
322 3300037068 Ga0373925_0167640 Ga0373925_0167640_1030_1599 185
323 3300037853 Ga0436364_1110329 Ga0436364_1110329_1186_1779 185
324 3300044683 Ga0466965_0088475 Ga0466965_0088475_120_716 185
325 3300044693 Ga0466961_0140333 Ga0466961_0140333_107_703 185
326 3300044694 Ga0466963_0139862 Ga0466963_0139862_790_1386 185
327 3300044719 Ga0466971_0084679 Ga0466971_0084679_741_1337 185
328 3300044842 Ga0466957_0222445 Ga0466957_0222445_281_877 185
329 3300045049 Ga0466959_0440776 Ga0466959_0440776_21_617 185
330 3300045051 Ga0451576_1280470 Ga0451576_1280470_144_740 185
331 3300045836 Ga0466958_0247231 Ga0466958_0247231_58_654 185
332 3300045976 Ga0466967_0069816 Ga0466967_0069816_679_1275 185
333 3300046463 Ga0495653_0402536 Ga0495653_0402536_126_695 185
334 3300046472 Ga0495580_0000068 Ga0495580_0000068_25919_26515 185
335 3300046472 Ga0495580_0048399 Ga0495580_0048399_1691_2260 185
336 3300046472 Ga0495580_0283368 Ga0495580_0283368_273_842 185
337 3300046473 Ga0495582_0000291 Ga0495582_0000291_15211_15780 185
338 3300046517 Ga0495630_0112947 Ga0495630_0112947_671_1267 185
339 3300046526 Ga0495666_0046554 Ga0495666_0046554_194_763 185
340 3300046531 Ga0495665_0026314 Ga0495665_0026314_1664_2233 185
341 3300046531 Ga0495665_0129909 Ga0495665_0129909_277_873 185
342 3300046531 Ga0495665_0266268 Ga0495665_0266268_264_833 185
343 3300046535 Ga0495586_0202657 Ga0495586_0202657_329_898 185
344 3300046536 Ga0495587_0085692 Ga0495587_0085692_1059_1655 185
345 3300046683 Ga0495658_0527980 Ga0495658_0527980_112_681 185
346 3300047315 Ga0495581_0435666 Ga0495581_0435666_69_665 185
347 3300047317 Ga0495604_0329445 Ga0495604_0329445_338_934 185
348 3300047319 Ga0495674_0103640 Ga0495674_0103640_1777_2346 185
349 3300047444 Ga0495675_0058923 Ga0495675_0058923_1055_1651 185
350 3300047471 Ga0495684_0501770 Ga0495684_0501770_72_668 185
351 3300048088 Ga0495602_0305789 Ga0495602_0305789_234_830 185
352 3300048903 Ga0496100_0488136 Ga0496100_0488136_19_615 185
353 3300048903 Ga0496100_0937622 Ga0496100_0937622_25_594 185
354 3300048905 Ga0496102_0340715 Ga0496102_0340715_147_743 185
355 3300048905 Ga0496102_0412569 Ga0496102_0412569_125_721 185
356 3300048907 Ga0496104_0065831 Ga0496104_0065831_1291_1860 185
357 3300048908 Ga0496105_0275814 Ga0496105_0275814_366_962 185
358 3300048913 Ga0496110_0734514 Ga0496110_0734514_256_852 185
359 3300048915 Ga0496112_0010933 Ga0496112_0010933_4292_4888 185
360 3300048915 Ga0496112_0011133 Ga0496112_0011133_3504_4100 185
361 3300048915 Ga0496112_0218716 Ga0496112_0218716_655_1251 185
362 3300048916 Ga0496113_0133330 Ga0496113_0133330_340_936 185
363 3300048916 Ga0496113_0418134 Ga0496113_0418134_25_621 185
364 3300050512 nmdc:mga0n895_819076_c1 nmdc:mga0n895_819076_c1_97_693 185
365 3300050514 nmdc:mga08x19_859_c1 nmdc:mga08x19_859_c1_3378_3947 185
366 3300053078 Ga0495612_0044444 Ga0495612_0044444_679_1275 185
367 3300059505 Ga0587083_0033283 Ga0587083_0033283_410_1006 185
368 3300002459 JGI24751J29686_10001273 JGI24751J29686_100012734 186
369 3300004800 Ga0058861_11821206 Ga0058861_118212061 186
370 3300004803 Ga0058862_12834571 Ga0058862_128345711 186
371 3300005327 Ga0070658_10069011 Ga0070658_100690114 186
372 3300005328 Ga0070676_10004549 Ga0070676_100045494 186
373 3300005329 Ga0070683_100011357 Ga0070683_1000113577 186
374 3300005330 Ga0070690_100042518 Ga0070690_1000425183 186
375 3300005331 Ga0070670_100116293 Ga0070670_1001162933 186
376 3300005334 Ga0068869_100089885 Ga0068869_1000898853 186
377 3300005334 Ga0068869_100244958 Ga0068869_1002449582 186
378 3300005335 Ga0070666_10054046 Ga0070666_100540463 186
379 3300005337 Ga0070682_100016275 Ga0070682_1000162752 186
380 3300005338 Ga0068868_100090258 Ga0068868_1000902582 186
381 3300005338 Ga0068868_100175989 Ga0068868_1001759892 186
382 3300005339 Ga0070660_100019827 Ga0070660_1000198274 186
383 3300005340 Ga0070689_100040309 Ga0070689_1000403092 186
384 3300005343 Ga0070687_100001627 Ga0070687_1000016277 186
385 3300005344 Ga0070661_100007433 Ga0070661_1000074337 186
386 3300005347 Ga0070668_100108119 Ga0070668_1001081192 186
387 3300005347 Ga0070668_100760337 Ga0070668_1007603371 186
388 3300005353 Ga0070669_100068238 Ga0070669_1000682381 186
389 3300005354 Ga0070675_100023143 Ga0070675_1000231434 186
390 3300005355 Ga0070671_100122010 Ga0070671_1001220102 186
391 3300005356 Ga0070674_100018353 Ga0070674_1000183533 186
392 3300005364 Ga0070673_100008843 Ga0070673_1000088432 186
393 3300005365 Ga0070688_100009674 Ga0070688_1000096742 186
394 3300005366 Ga0070659_100028812 Ga0070659_1000288122 186
395 3300005367 Ga0070667_100241782 Ga0070667_1002417822 186
396 3300005434 Ga0070709_10003196 Ga0070709_100031966 186
397 3300005436 Ga0070713_100000569 Ga0070713_1000005694 186
398 3300005436 Ga0070713_100242057 Ga0070713_1002420572 186
399 3300005437 Ga0070710_10010073 Ga0070710_100100735 186
400 3300005439 Ga0070711_100281402 Ga0070711_1002814022 186
401 3300005444 Ga0070694_100270029 Ga0070694_1002700291 186
402 3300005445 Ga0070708_100103449 Ga0070708_1001034494 186
403 3300005455 Ga0070663_100085535 Ga0070663_1000855352 186
404 3300005457 Ga0070662_100016025 Ga0070662_1000160255 186
405 3300005458 Ga0070681_10024591 Ga0070681_100245915 186
406 3300005458 Ga0070681_10424738 Ga0070681_104247381 186
407 3300005459 Ga0068867_100018978 Ga0068867_1000189784 186
408 3300005466 Ga0070685_10000797 Ga0070685_100007975 186
409 3300005467 Ga0070706_100069319 Ga0070706_1000693192 186
410 3300005468 Ga0070707_100309713 Ga0070707_1003097132 186
411 3300005471 Ga0070698_100161985 Ga0070698_1001619851 186
412 3300005530 Ga0070679_100012185 Ga0070679_1000121856 186
413 3300005535 Ga0070684_100004113 Ga0070684_1000041137 186
414 3300005536 Ga0070697_100642296 Ga0070697_1006422962 186
415 3300005539 Ga0068853_100012490 Ga0068853_1000124907 186
416 3300005543 Ga0070672_100048312 Ga0070672_1000483122 186
417 3300005563 Ga0068855_100018006 Ga0068855_1000180062 186
418 3300005564 Ga0070664_100266771 Ga0070664_1002667712 186
419 3300005577 Ga0068857_100002428 Ga0068857_1000024284 186
420 3300005577 Ga0068857_100286927 Ga0068857_1002869272 186
421 3300005578 Ga0068854_100089977 Ga0068854_1000899772 186
422 3300005614 Ga0068856_100456165 Ga0068856_1004561651 186
423 3300005616 Ga0068852_100116779 Ga0068852_1001167792 186
424 3300005718 Ga0068866_10016537 Ga0068866_100165372 186
425 3300005719 Ga0068861_100061273 Ga0068861_1000612733 186
426 3300005834 Ga0068851_10032375 Ga0068851_100323753 186
427 3300005840 Ga0068870_10014885 Ga0068870_100148853 186
428 3300005841 Ga0068863_100178505 Ga0068863_1001785052 186
429 3300005842 Ga0068858_100009627 Ga0068858_1000096276 186
430 3300005843 Ga0068860_100040235 Ga0068860_1000402354 186
431 3300005844 Ga0068862_100089621 Ga0068862_1000896212 186
432 3300006028 Ga0070717_10022998 Ga0070717_100229983 186
433 3300006163 Ga0070715_10131266 Ga0070715_101312662 186
434 3300006173 Ga0070716_100013373 Ga0070716_1000133734 186
435 3300006175 Ga0070712_100000708 Ga0070712_10000070818 186
436 3300006175 Ga0070712_100173881 Ga0070712_1001738812 186
437 3300006175 Ga0070712_100996098 Ga0070712_1009960982 186
438 3300006358 Ga0068871_100199812 Ga0068871_1001998122 186
439 3300006358 Ga0068871_100361836 Ga0068871_1003618362 186
440 3300006852 Ga0075433_10067212 Ga0075433_100672123 186
441 3300006852 Ga0075433_10474415 Ga0075433_104744152 186
442 3300006871 Ga0075434_100003658 Ga0075434_1000036589 186
443 3300006881 Ga0068865_100385278 Ga0068865_1003852782 186
444 3300007076 Ga0075435_100321593 Ga0075435_1003215931 186
445 3300007265 Ga0099794_10130754 Ga0099794_101307541 186
446 3300009011 Ga0105251_10187492 Ga0105251_101874921 186
447 3300009092 Ga0105250_10103101 Ga0105250_101031011 186
448 3300009092 Ga0105250_10122046 Ga0105250_101220462 186
449 3300009094 Ga0111539_10415590 Ga0111539_104155902 186
450 3300009098 Ga0105245_10059246 Ga0105245_100592463 186
451 3300009098 Ga0105245_10062536 Ga0105245_100625364 186
452 3300009101 Ga0105247_10001613 Ga0105247_1000161310 186
453 3300009148 Ga0105243_11132394 Ga0105243_111323942 186
454 3300009174 Ga0105241_10023344 Ga0105241_100233442 186
455 3300009176 Ga0105242_10498187 Ga0105242_104981871 186
456 3300009177 Ga0105248_10023146 Ga0105248_100231467 186
457 3300009553 Ga0105249_10006286 Ga0105249_100062862 186
458 3300009553 Ga0105249_10034638 Ga0105249_100346384 186
459 3300010375 Ga0105239_10080930 Ga0105239_100809302 186
460 3300011119 Ga0105246_10091932 Ga0105246_100919321 186
461 3300012506 Ga0157324_1013069 Ga0157324_10130691 186
462 3300013100 Ga0157373_10013739 Ga0157373_100137396 186
463 3300013102 Ga0157371_10185360 Ga0157371_101853602 186
464 3300013105 Ga0157369_10030134 Ga0157369_100301341 186
465 3300013296 Ga0157374_10239140 Ga0157374_102391402 186
466 3300013296 Ga0157374_10311953 Ga0157374_103119532 186
467 3300013306 Ga0163162_10088580 Ga0163162_100885802 186
468 3300013306 Ga0163162_10469048 Ga0163162_104690482 186
469 3300013307 Ga0157372_10052890 Ga0157372_100528902 186
470 3300014325 Ga0163163_10005648 Ga0163163_100056488 186
471 3300014326 Ga0157380_10017537 Ga0157380_100175373 186
472 3300014745 Ga0157377_10000230 Ga0157377_100002309 186
473 3300014968 Ga0157379_10008716 Ga0157379_100087168 186
474 3300014968 Ga0157379_10462791 Ga0157379_104627912 186
475 3300017792 Ga0163161_10012941 Ga0163161_100129414 186
476 3300025315 Ga0207697_10003863 Ga0207697_100038635 186
477 3300025321 Ga0207656_10019855 Ga0207656_100198552 186
478 3300025898 Ga0207692_10034448 Ga0207692_100344481 186
479 3300025899 Ga0207642_10004367 Ga0207642_100043673 186
480 3300025901 Ga0207688_10014841 Ga0207688_100148412 186
481 3300025903 Ga0207680_10101778 Ga0207680_101017782 186
482 3300025904 Ga0207647_10017691 Ga0207647_100176915 186
483 3300025906 Ga0207699_10000423 Ga0207699_1000042319 186
484 3300025907 Ga0207645_10000376 Ga0207645_1000037613 186
485 3300025908 Ga0207643_10000194 Ga0207643_1000019422 186
486 3300025909 Ga0207705_10046569 Ga0207705_100465694 186
487 3300025911 Ga0207654_10420364 Ga0207654_104203641 186
488 3300025912 Ga0207707_10018040 Ga0207707_100180404 186
489 3300025912 Ga0207707_10499169 Ga0207707_104991692 186
490 3300025915 Ga0207693_10000024 Ga0207693_100000241 186
491 3300025915 Ga0207693_10513648 Ga0207693_105136482 186
492 3300025916 Ga0207663_10350788 Ga0207663_103507882 186
493 3300025917 Ga0207660_10281806 Ga0207660_102818062 186
494 3300025918 Ga0207662_10001408 Ga0207662_100014084 186
495 3300025919 Ga0207657_10010820 Ga0207657_100108205 186
496 3300025920 Ga0207649_10001260 Ga0207649_100012602 186
497 3300025922 Ga0207646_10120223 Ga0207646_101202234 186
498 3300025922 Ga0207646_10749878 Ga0207646_107498781 186
499 3300025925 Ga0207650_10000216 Ga0207650_1000021628 186
500 3300025925 Ga0207650_10275198 Ga0207650_102751982 186
501 3300025926 Ga0207659_10178763 Ga0207659_101787631 186
502 3300025928 Ga0207700_10025588 Ga0207700_100255884 186
503 3300025928 Ga0207700_10163626 Ga0207700_101636262 186
504 3300025928 Ga0207700_10195915 Ga0207700_101959152 186
505 3300025929 Ga0207664_10293729 Ga0207664_102937292 186
506 3300025931 Ga0207644_10086751 Ga0207644_100867513 186
507 3300025932 Ga0207690_10033647 Ga0207690_100336472 186
508 3300025933 Ga0207706_10032789 Ga0207706_100327893 186
509 3300025936 Ga0207670_10001554 Ga0207670_100015548 186
510 3300025937 Ga0207669_10036908 Ga0207669_100369081 186
511 3300025940 Ga0207691_10000459 Ga0207691_1000045929 186
512 3300025941 Ga0207711_10002757 Ga0207711_1000275716 186
513 3300025942 Ga0207689_10001458 Ga0207689_1000145818 186
514 3300025942 Ga0207689_10135088 Ga0207689_101350882 186
515 3300025944 Ga0207661_10001667 Ga0207661_100016679 186
516 3300025945 Ga0207679_10000496 Ga0207679_1000049624 186
517 3300025949 Ga0207667_10339491 Ga0207667_103394912 186
518 3300025960 Ga0207651_10064958 Ga0207651_100649583 186
519 3300025961 Ga0207712_10021189 Ga0207712_100211892 186
520 3300025972 Ga0207668_10169345 Ga0207668_101693452 186
521 3300025981 Ga0207640_10112138 Ga0207640_101121382 186
522 3300025986 Ga0207658_10147651 Ga0207658_101476512 186
523 3300025986 Ga0207658_10187202 Ga0207658_101872022 186
524 3300026023 Ga0207677_10018312 Ga0207677_100183121 186
525 3300026035 Ga0207703_10048898 Ga0207703_100488982 186
526 3300026041 Ga0207639_10206472 Ga0207639_102064722 186
527 3300026067 Ga0207678_10000328 Ga0207678_1000032822 186
528 3300026088 Ga0207641_10001283 Ga0207641_1000128322 186
529 3300026089 Ga0207648_10000826 Ga0207648_1000082623 186
530 3300026095 Ga0207676_10000058 Ga0207676_1000005873 186
531 3300026116 Ga0207674_10000148 Ga0207674_1000014828 186
532 3300026116 Ga0207674_10049534 Ga0207674_100495342 186
533 3300026118 Ga0207675_100275256 Ga0207675_1002752562 186
534 3300026121 Ga0207683_10013575 Ga0207683_100135754 186
535 3300028380 Ga0268265_10026162 Ga0268265_100261626 186
536 3300028381 Ga0268264_10093906 Ga0268264_100939063 186
537 3300028381 Ga0268264_10278252 Ga0268264_102782522 186
538 3300030878 Ga0265770_1002756 Ga0265770_10027563 186
539 3300031090 Ga0265760_10000172 Ga0265760_100001725 186
540 3300031090 Ga0265760_10006480 Ga0265760_100064803 186
541 3300031090 Ga0265760_10071720 Ga0265760_100717202 186
542 3300033547 Ga0316212_1022695 Ga0316212_10226952 186
543 3300035170 Ga0373943_0119556 Ga0373943_0119556_810_1382 186
544 3300035724 Ga0373933_0331108 Ga0373933_0331108_171_743 186
545 3300036401 Ga0373937_0102846 Ga0373937_0102846_1741_2304 186
546 3300039438 Ga0436360_0028730 Ga0436360_0028730_1649_2215 186
547 3300039453 Ga0436362_1017484 Ga0436362_1017484_47_610 186
548 3300046472 Ga0495580_0047143 Ga0495580_0047143_675_1247 186
549 3300046517 Ga0495630_0572127 Ga0495630_0572127_207_782 186
550 3300047319 Ga0495674_0139553 Ga0495674_0139553_328_900 186
551 3300047319 Ga0495674_0648838 Ga0495674_0648838_94_666 186
552 3300048904 Ga0496101_0450630 Ga0496101_0450630_226_789 186
553 3300048905 Ga0496102_0053318 Ga0496102_0053318_2751_3314 186
554 3300048905 Ga0496102_0396889 Ga0496102_0396889_70_633 186
555 3300048909 Ga0496106_0359074 Ga0496106_0359074_551_1114 186
556 3300048911 Ga0496108_0000170 Ga0496108_0000170_21636_22199 186
557 3300048912 Ga0496109_0000621 Ga0496109_0000621_4922_5485 186
558 3300048913 Ga0496110_0019980 Ga0496110_0019980_846_1409 186
559 3300048914 Ga0496111_0371204 Ga0496111_0371204_232_795 186
560 3300048915 Ga0496112_0000152 Ga0496112_0000152_36151_36714 186
561 3300048915 Ga0496112_0749567 Ga0496112_0749567_62_625 186
562 3300048916 Ga0496113_0018313 Ga0496113_0018313_3907_4470 186
563 3300048918 Ga0496115_0043711 Ga0496115_0043711_2859_3422 186
564 3300050512 nmdc:mga0n895_1999_c1 nmdc:mga0n895_1999_c1_7621_8316 186
565 3300050515 nmdc:mga0a205_164152_c1 nmdc:mga0a205_164152_c1_208_903 186
566 3300053078 Ga0495612_0171175 Ga0495612_0171175_44_616 186
567 2162886012 MBSR1b_contig_8075501 MBSR1b_0328.00005470 187
568 3300005290 Ga0065712_10086293 Ga0065712_100862933 187
569 3300005293 Ga0065715_10236585 Ga0065715_102365852 187
570 3300005329 Ga0070683_100073917 Ga0070683_1000739174 187
571 3300005330 Ga0070690_100006782 Ga0070690_1000067823 187
572 3300005331 Ga0070670_100055647 Ga0070670_1000556474 187
573 3300005334 Ga0068869_100173917 Ga0068869_1001739172 187
574 3300005335 Ga0070666_10010790 Ga0070666_100107904 187
575 3300005335 Ga0070666_10265759 Ga0070666_102657592 187
576 3300005336 Ga0070680_100235706 Ga0070680_1002357062 187
577 3300005337 Ga0070682_100012261 Ga0070682_1000122614 187
578 3300005337 Ga0070682_100060121 Ga0070682_1000601213 187
579 3300005338 Ga0068868_100040602 Ga0068868_1000406022 187
580 3300005338 Ga0068868_100272670 Ga0068868_1002726702 187
581 3300005339 Ga0070660_100015581 Ga0070660_1000155814 187
582 3300005339 Ga0070660_100068642 Ga0070660_1000686422 187
583 3300005344 Ga0070661_100022951 Ga0070661_1000229512 187
584 3300005344 Ga0070661_100282225 Ga0070661_1002822252 187
585 3300005345 Ga0070692_10061273 Ga0070692_100612732 187
586 3300005347 Ga0070668_100043770 Ga0070668_1000437702 187
587 3300005353 Ga0070669_100202873 Ga0070669_1002028732 187
588 3300005355 Ga0070671_100057674 Ga0070671_1000576743 187
589 3300005366 Ga0070659_100010808 Ga0070659_1000108082 187
590 3300005366 Ga0070659_100028466 Ga0070659_1000284663 187
591 3300005367 Ga0070667_100018917 Ga0070667_1000189176 187
592 3300005367 Ga0070667_100741985 Ga0070667_1007419851 187
593 3300005367 Ga0070667_100906509 Ga0070667_1009065092 187
594 3300005434 Ga0070709_10033980 Ga0070709_100339802 187
595 3300005434 Ga0070709_10070113 Ga0070709_100701133 187
596 3300005435 Ga0070714_100003775 Ga0070714_1000037755 187
597 3300005436 Ga0070713_100009328 Ga0070713_1000093285 187
598 3300005436 Ga0070713_100074368 Ga0070713_1000743683 187
599 3300005436 Ga0070713_100192372 Ga0070713_1001923724 187
600 3300005436 Ga0070713_100245534 Ga0070713_1002455341 187
601 3300005436 Ga0070713_101290489 Ga0070713_1012904891 187
602 3300005437 Ga0070710_10029956 Ga0070710_100299563 187
603 3300005439 Ga0070711_100003297 Ga0070711_1000032975 187
604 3300005439 Ga0070711_100006867 Ga0070711_1000068674 187
605 3300005439 Ga0070711_100256528 Ga0070711_1002565282 187
606 3300005439 Ga0070711_100798451 Ga0070711_1007984511 187
607 3300005445 Ga0070708_100013578 Ga0070708_1000135787 187
608 3300005445 Ga0070708_100016686 Ga0070708_1000166864 187
609 3300005445 Ga0070708_100018605 Ga0070708_1000186054 187
610 3300005445 Ga0070708_100425606 Ga0070708_1004256062 187
611 3300005445 Ga0070708_100632224 Ga0070708_1006322242 187
612 3300005455 Ga0070663_100096309 Ga0070663_1000963093 187
613 3300005456 Ga0070678_100301407 Ga0070678_1003014072 187
614 3300005456 Ga0070678_100677526 Ga0070678_1006775262 187
615 3300005457 Ga0070662_100001509 Ga0070662_10000150912 187
616 3300005458 Ga0070681_10072813 Ga0070681_100728131 187
617 3300005458 Ga0070681_10074313 Ga0070681_100743133 187
618 3300005458 Ga0070681_10101548 Ga0070681_101015482 187
619 3300005459 Ga0068867_100061067 Ga0068867_1000610674 187
620 3300005466 Ga0070685_10066079 Ga0070685_100660792 187
621 3300005467 Ga0070706_100000454 Ga0070706_10000045432 187
622 3300005467 Ga0070706_100002171 Ga0070706_10000217115 187
623 3300005467 Ga0070706_100033498 Ga0070706_1000334983 187
624 3300005467 Ga0070706_100089643 Ga0070706_1000896433 187
625 3300005467 Ga0070706_100102492 Ga0070706_1001024923 187
626 3300005468 Ga0070707_100001443 Ga0070707_1000014434 187
627 3300005468 Ga0070707_100010916 Ga0070707_1000109166 187
628 3300005468 Ga0070707_100031745 Ga0070707_1000317454 187
629 3300005468 Ga0070707_101027885 Ga0070707_1010278851 187
630 3300005471 Ga0070698_100000216 Ga0070698_10000021632 187
631 3300005471 Ga0070698_100833582 Ga0070698_1008335822 187
632 3300005518 Ga0070699_100017274 Ga0070699_1000172745 187
633 3300005530 Ga0070679_100070772 Ga0070679_1000707722 187
634 3300005530 Ga0070679_100103365 Ga0070679_1001033652 187
635 3300005530 Ga0070679_100474383 Ga0070679_1004743832 187
636 3300005535 Ga0070684_100036867 Ga0070684_1000368672 187
637 3300005535 Ga0070684_100132654 Ga0070684_1001326542 187
638 3300005536 Ga0070697_100001523 Ga0070697_10000152311 187
639 3300005536 Ga0070697_100055246 Ga0070697_1000552462 187
640 3300005536 Ga0070697_100092384 Ga0070697_1000923842 187
641 3300005536 Ga0070697_100199755 Ga0070697_1001997551 187
642 3300005536 Ga0070697_100380771 Ga0070697_1003807711 187
643 3300005536 Ga0070697_100562381 Ga0070697_1005623811 187
644 3300005536 Ga0070697_100637354 Ga0070697_1006373541 187
645 3300005539 Ga0068853_100040217 Ga0068853_1000402174 187
646 3300005539 Ga0068853_100118454 Ga0068853_1001184542 187
647 3300005544 Ga0070686_100010765 Ga0070686_1000107654 187
648 3300005545 Ga0070695_100013438 Ga0070695_1000134383 187
649 3300005545 Ga0070695_100210979 Ga0070695_1002109792 187
650 3300005546 Ga0070696_100168212 Ga0070696_1001682122 187
651 3300005546 Ga0070696_100335292 Ga0070696_1003352921 187
652 3300005547 Ga0070693_100009042 Ga0070693_1000090422 187
653 3300005547 Ga0070693_100441959 Ga0070693_1004419592 187
654 3300005547 Ga0070693_100841538 Ga0070693_1008415381 187
655 3300005548 Ga0070665_100050113 Ga0070665_1000501135 187
656 3300005548 Ga0070665_100429110 Ga0070665_1004291101 187
657 3300005549 Ga0070704_100461517 Ga0070704_1004615172 187
658 3300005563 Ga0068855_100166960 Ga0068855_1001669604 187
659 3300005563 Ga0068855_100398673 Ga0068855_1003986732 187
660 3300005564 Ga0070664_100018900 Ga0070664_1000189004 187
661 3300005564 Ga0070664_100049580 Ga0070664_1000495802 187
662 3300005564 Ga0070664_100493833 Ga0070664_1004938332 187
663 3300005577 Ga0068857_100056730 Ga0068857_1000567302 187
664 3300005577 Ga0068857_100202557 Ga0068857_1002025572 187
665 3300005578 Ga0068854_100161548 Ga0068854_1001615481 187
666 3300005614 Ga0068856_100048394 Ga0068856_1000483943 187
667 3300005614 Ga0068856_100106639 Ga0068856_1001066393 187
668 3300005614 Ga0068856_100307703 Ga0068856_1003077032 187
669 3300005616 Ga0068852_100180529 Ga0068852_1001805292 187
670 3300005616 Ga0068852_100319699 Ga0068852_1003196993 187
671 3300005617 Ga0068859_100015249 Ga0068859_1000152494 187
672 3300005618 Ga0068864_100271583 Ga0068864_1002715832 187
673 3300005718 Ga0068866_10021658 Ga0068866_100216583 187
674 3300005834 Ga0068851_10007945 Ga0068851_100079453 187
675 3300005841 Ga0068863_100056594 Ga0068863_1000565943 187
676 3300005841 Ga0068863_100058737 Ga0068863_1000587373 187
677 3300005842 Ga0068858_100026465 Ga0068858_1000264654 187
678 3300005842 Ga0068858_100233188 Ga0068858_1002331882 187
679 3300005843 Ga0068860_100060161 Ga0068860_1000601612 187
680 3300005844 Ga0068862_100215943 Ga0068862_1002159432 187
681 3300006028 Ga0070717_10019684 Ga0070717_100196843 187
682 3300006028 Ga0070717_10039792 Ga0070717_100397923 187
683 3300006028 Ga0070717_10329442 Ga0070717_103294421 187
684 3300006028 Ga0070717_10406145 Ga0070717_104061452 187
685 3300006028 Ga0070717_10974984 Ga0070717_109749842 187
686 3300006163 Ga0070715_10020920 Ga0070715_100209202 187
687 3300006163 Ga0070715_10033486 Ga0070715_100334863 187
688 3300006163 Ga0070715_10054611 Ga0070715_100546112 187
689 3300006173 Ga0070716_100000426 Ga0070716_10000042617 187
690 3300006173 Ga0070716_100031549 Ga0070716_1000315492 187
691 3300006173 Ga0070716_100035419 Ga0070716_1000354192 187
692 3300006173 Ga0070716_100039461 Ga0070716_1000394613 187
693 3300006173 Ga0070716_100042771 Ga0070716_1000427712 187
694 3300006173 Ga0070716_100341712 Ga0070716_1003417122 187
695 3300006175 Ga0070712_100000375 Ga0070712_1000003753 187
696 3300006175 Ga0070712_100000952 Ga0070712_10000095210 187
697 3300006175 Ga0070712_100153506 Ga0070712_1001535063 187
698 3300006175 Ga0070712_100884971 Ga0070712_1008849711 187
699 3300006237 Ga0097621_100138738 Ga0097621_1001387382 187
700 3300006237 Ga0097621_100292498 Ga0097621_1002924981 187
701 3300006358 Ga0068871_100025052 Ga0068871_1000250525 187
702 3300006358 Ga0068871_100125464 Ga0068871_1001254642 187
703 3300006358 Ga0068871_100254468 Ga0068871_1002544682 187
704 3300006852 Ga0075433_10020011 Ga0075433_100200116 187
705 3300006871 Ga0075434_100000460 Ga0075434_10000046027 187
706 3300006871 Ga0075434_100039922 Ga0075434_1000399223 187
707 3300006881 Ga0068865_100134911 Ga0068865_1001349112 187
708 3300006881 Ga0068865_100527383 Ga0068865_1005273832 187
709 3300006914 Ga0075436_100010225 Ga0075436_1000102253 187
710 3300006914 Ga0075436_100164013 Ga0075436_1001640132 187
711 3300006931 Ga0097620_100015248 Ga0097620_1000152484 187
712 3300007076 Ga0075435_100000141 Ga0075435_10000014131 187
713 3300009093 Ga0105240_10023147 Ga0105240_100231473 187
714 3300009093 Ga0105240_10088126 Ga0105240_100881263 187
715 3300009093 Ga0105240_10287080 Ga0105240_102870802 187
716 3300009093 Ga0105240_10331301 Ga0105240_103313012 187
717 3300009098 Ga0105245_10070411 Ga0105245_100704113 187
718 3300009101 Ga0105247_10025257 Ga0105247_100252573 187
719 3300009101 Ga0105247_10038216 Ga0105247_100382163 187
720 3300009148 Ga0105243_10858585 Ga0105243_108585851 187
721 3300009174 Ga0105241_10026676 Ga0105241_100266763 187
722 3300009174 Ga0105241_10050807 Ga0105241_100508074 187
723 3300009174 Ga0105241_10085581 Ga0105241_100855812 187
724 3300009174 Ga0105241_10218798 Ga0105241_102187982 187
725 3300009174 Ga0105241_10258244 Ga0105241_102582441 187
726 3300009176 Ga0105242_10045283 Ga0105242_100452831 187
727 3300009176 Ga0105242_10081210 Ga0105242_100812102 187
728 3300009177 Ga0105248_10111178 Ga0105248_101111782 187
729 3300009177 Ga0105248_10119859 Ga0105248_101198591 187
730 3300009177 Ga0105248_10734650 Ga0105248_107346502 187
731 3300009545 Ga0105237_10021829 Ga0105237_100218293 187
732 3300009545 Ga0105237_10299535 Ga0105237_102995351 187
733 3300009551 Ga0105238_10023454 Ga0105238_100234543 187
734 3300009551 Ga0105238_10037684 Ga0105238_100376843 187
735 3300009551 Ga0105238_10055918 Ga0105238_100559182 187
736 3300009553 Ga0105249_10025448 Ga0105249_100254483 187
737 3300009553 Ga0105249_10961789 Ga0105249_109617892 187
738 3300010375 Ga0105239_10373781 Ga0105239_103737812 187
739 3300011119 Ga0105246_10065236 Ga0105246_100652362 187
740 3300013100 Ga0157373_10032458 Ga0157373_100324582 187
741 3300013100 Ga0157373_10130589 Ga0157373_101305891 187
742 3300013100 Ga0157373_10189097 Ga0157373_101890972 187
743 3300013102 Ga0157371_10010976 Ga0157371_100109763 187
744 3300013105 Ga0157369_10250963 Ga0157369_102509632 187
745 3300013296 Ga0157374_10022134 Ga0157374_100221344 187
746 3300013296 Ga0157374_10072470 Ga0157374_100724703 187
747 3300013296 Ga0157374_10531583 Ga0157374_105315832 187
748 3300013297 Ga0157378_10053001 Ga0157378_100530012 187
749 3300013297 Ga0157378_10169006 Ga0157378_101690061 187
750 3300013297 Ga0157378_10567007 Ga0157378_105670072 187
751 3300013297 Ga0157378_10859808 Ga0157378_108598081 187
752 3300013297 Ga0157378_11095831 Ga0157378_110958311 187
753 3300013306 Ga0163162_10001366 Ga0163162_100013666 187
754 3300013306 Ga0163162_10004521 Ga0163162_100045214 187
755 3300013306 Ga0163162_10425830 Ga0163162_104258301 187
756 3300013307 Ga0157372_10148560 Ga0157372_101485603 187
757 3300013308 Ga0157375_10039878 Ga0157375_100398783 187
758 3300014325 Ga0163163_10191042 Ga0163163_101910422 187
759 3300014325 Ga0163163_10607816 Ga0163163_106078162 187
760 3300014497 Ga0182008_10008926 Ga0182008_100089266 187
761 3300014497 Ga0182008_10075420 Ga0182008_100754202 187
762 3300014968 Ga0157379_10017268 Ga0157379_100172686 187
763 3300014968 Ga0157379_10033479 Ga0157379_100334793 187
764 3300014968 Ga0157379_10088166 Ga0157379_100881661 187
765 3300014969 Ga0157376_10031533 Ga0157376_100315332 187
766 3300014969 Ga0157376_10049823 Ga0157376_100498231 187
767 3300014969 Ga0157376_10096542 Ga0157376_100965423 187
768 3300014969 Ga0157376_10127883 Ga0157376_101278832 187
769 3300015261 Ga0182006_1109024 Ga0182006_11090241 187
770 3300015262 Ga0182007_10034176 Ga0182007_100341762 187
771 3300015262 Ga0182007_10053490 Ga0182007_100534902 187
772 3300020080 Ga0206350_10675980 Ga0206350_106759802 187
773 3300022467 Ga0224712_10237503 Ga0224712_102375031 187
774 3300022730 Ga0224570_101218 Ga0224570_1012183 187
775 3300022732 Ga0224569_103894 Ga0224569_1038942 187
776 3300024225 Ga0224572_1019941 Ga0224572_10199412 187
777 3300024227 Ga0228598_1001017 Ga0228598_10010177 187
778 3300025321 Ga0207656_10008807 Ga0207656_100088073 187
779 3300025898 Ga0207692_10018782 Ga0207692_100187823 187
780 3300025898 Ga0207692_10067239 Ga0207692_100672392 187
781 3300025899 Ga0207642_10269048 Ga0207642_102690481 187
782 3300025900 Ga0207710_10034258 Ga0207710_100342583 187
783 3300025900 Ga0207710_10038745 Ga0207710_100387453 187
784 3300025903 Ga0207680_10113856 Ga0207680_101138562 187
785 3300025905 Ga0207685_10018401 Ga0207685_100184014 187
786 3300025905 Ga0207685_10177591 Ga0207685_101775912 187
787 3300025906 Ga0207699_10005111 Ga0207699_100051116 187
788 3300025906 Ga0207699_10182271 Ga0207699_101822711 187
789 3300025906 Ga0207699_10240810 Ga0207699_102408101 187
790 3300025907 Ga0207645_10037470 Ga0207645_100374703 187
791 3300025910 Ga0207684_10002803 Ga0207684_100028039 187
792 3300025910 Ga0207684_10003642 Ga0207684_100036422 187
793 3300025910 Ga0207684_10066315 Ga0207684_100663153 187
794 3300025910 Ga0207684_10128330 Ga0207684_101283302 187
795 3300025910 Ga0207684_10213260 Ga0207684_102132601 187
796 3300025911 Ga0207654_10046310 Ga0207654_100463102 187
797 3300025911 Ga0207654_10049753 Ga0207654_100497532 187
798 3300025911 Ga0207654_10198775 Ga0207654_101987752 187
799 3300025912 Ga0207707_10003464 Ga0207707_1000346413 187
800 3300025912 Ga0207707_10034361 Ga0207707_100343615 187
801 3300025913 Ga0207695_10071973 Ga0207695_100719734 187
802 3300025914 Ga0207671_10020926 Ga0207671_100209264 187
803 3300025914 Ga0207671_10158462 Ga0207671_101584622 187
804 3300025915 Ga0207693_10000214 Ga0207693_1000021426 187
805 3300025915 Ga0207693_10001731 Ga0207693_100017318 187
806 3300025915 Ga0207693_10045616 Ga0207693_100456161 187
807 3300025915 Ga0207693_10195472 Ga0207693_101954722 187
808 3300025915 Ga0207693_10238573 Ga0207693_102385732 187
809 3300025916 Ga0207663_10007091 Ga0207663_100070915 187
810 3300025916 Ga0207663_10008315 Ga0207663_100083155 187
811 3300025916 Ga0207663_10024149 Ga0207663_100241494 187
812 3300025916 Ga0207663_10077451 Ga0207663_100774512 187
813 3300025916 Ga0207663_10185342 Ga0207663_101853422 187
814 3300025916 Ga0207663_10617102 Ga0207663_106171021 187
815 3300025917 Ga0207660_10336398 Ga0207660_103363981 187
816 3300025917 Ga0207660_10386048 Ga0207660_103860482 187
817 3300025919 Ga0207657_10002947 Ga0207657_1000294711 187
818 3300025919 Ga0207657_10004279 Ga0207657_100042797 187
819 3300025920 Ga0207649_10037225 Ga0207649_100372252 187
820 3300025920 Ga0207649_10043965 Ga0207649_100439653 187
821 3300025921 Ga0207652_10292653 Ga0207652_102926532 187
822 3300025921 Ga0207652_10346332 Ga0207652_103463322 187
823 3300025921 Ga0207652_10887227 Ga0207652_108872271 187
824 3300025922 Ga0207646_10001233 Ga0207646_1000123320 187
825 3300025922 Ga0207646_10006853 Ga0207646_100068536 187
826 3300025922 Ga0207646_10283858 Ga0207646_102838582 187
827 3300025922 Ga0207646_10424835 Ga0207646_104248352 187
828 3300025922 Ga0207646_10479440 Ga0207646_104794401 187
829 3300025922 Ga0207646_11186073 Ga0207646_111860731 187
830 3300025922 Ga0207646_11394985 Ga0207646_113949851 187
831 3300025924 Ga0207694_10031776 Ga0207694_100317764 187
832 3300025924 Ga0207694_10065067 Ga0207694_100650673 187
833 3300025928 Ga0207700_10003049 Ga0207700_100030498 187
834 3300025928 Ga0207700_10022345 Ga0207700_100223454 187
835 3300025928 Ga0207700_10122746 Ga0207700_101227462 187
836 3300025928 Ga0207700_10187467 Ga0207700_101874672 187
837 3300025928 Ga0207700_10356448 Ga0207700_103564482 187
838 3300025928 Ga0207700_10478464 Ga0207700_104784642 187
839 3300025929 Ga0207664_10000607 Ga0207664_100006078 187
840 3300025929 Ga0207664_10003402 Ga0207664_100034022 187
841 3300025929 Ga0207664_10065055 Ga0207664_100650553 187
842 3300025929 Ga0207664_10235165 Ga0207664_102351652 187
843 3300025931 Ga0207644_10040273 Ga0207644_100402732 187
844 3300025931 Ga0207644_10637881 Ga0207644_106378811 187
845 3300025932 Ga0207690_10053600 Ga0207690_100536003 187
846 3300025932 Ga0207690_10078606 Ga0207690_100786063 187
847 3300025933 Ga0207706_10000868 Ga0207706_1000086814 187
848 3300025933 Ga0207706_10014363 Ga0207706_100143633 187
849 3300025938 Ga0207704_10021498 Ga0207704_100214984 187
850 3300025938 Ga0207704_10631510 Ga0207704_106315101 187
851 3300025939 Ga0207665_10000329 Ga0207665_1000032928 187
852 3300025939 Ga0207665_10037027 Ga0207665_100370275 187
853 3300025939 Ga0207665_10041249 Ga0207665_100412492 187
854 3300025939 Ga0207665_10106501 Ga0207665_101065013 187
855 3300025939 Ga0207665_10140359 Ga0207665_101403592 187
856 3300025939 Ga0207665_10212331 Ga0207665_102123312 187
857 3300025939 Ga0207665_10472234 Ga0207665_104722341 187
858 3300025941 Ga0207711_10004875 Ga0207711_100048754 187
859 3300025941 Ga0207711_10403708 Ga0207711_104037082 187
860 3300025942 Ga0207689_10031999 Ga0207689_100319995 187
861 3300025945 Ga0207679_10013182 Ga0207679_100131823 187
862 3300025945 Ga0207679_10238884 Ga0207679_102388842 187
863 3300025961 Ga0207712_10032280 Ga0207712_100322804 187
864 3300025972 Ga0207668_10018828 Ga0207668_100188285 187
865 3300025981 Ga0207640_10189376 Ga0207640_101893762 187
866 3300025986 Ga0207658_10714698 Ga0207658_107146981 187
867 3300026023 Ga0207677_10029386 Ga0207677_100293862 187
868 3300026067 Ga0207678_10002447 Ga0207678_100024475 187
869 3300026067 Ga0207678_10124199 Ga0207678_101241993 187
870 3300026078 Ga0207702_10020286 Ga0207702_100202863 187
871 3300026078 Ga0207702_10432549 Ga0207702_104325492 187
872 3300026078 Ga0207702_10602011 Ga0207702_106020112 187
873 3300026088 Ga0207641_10296256 Ga0207641_102962562 187
874 3300026088 Ga0207641_10923134 Ga0207641_109231341 187
875 3300026089 Ga0207648_10066105 Ga0207648_100661053 187
876 3300026089 Ga0207648_10755061 Ga0207648_107550611 187
877 3300026116 Ga0207674_10058791 Ga0207674_100587912 187
878 3300026116 Ga0207674_10186877 Ga0207674_101868772 187
879 3300026121 Ga0207683_10153126 Ga0207683_101531263 187
880 3300026142 Ga0207698_10131924 Ga0207698_101319242 187
881 3300027671 Ga0209588_1140410 Ga0209588_11404101 187
882 3300028017 Ga0265356_1000040 Ga0265356_100004025 187
883 3300028379 Ga0268266_10074822 Ga0268266_100748222 187
884 3300028379 Ga0268266_10396620 Ga0268266_103966201 187
885 3300028380 Ga0268265_10212363 Ga0268265_102123631 187
886 3300028381 Ga0268264_10175561 Ga0268264_101755612 187
887 3300028800 Ga0265338_10008016 Ga0265338_100080165 187
888 3300028800 Ga0265338_10099047 Ga0265338_100990472 187
889 3300030760 Ga0265762_1002743 Ga0265762_10027432 187
890 3300030760 Ga0265762_1012728 Ga0265762_10127281 187
891 3300031090 Ga0265760_10008939 Ga0265760_100089392 187
892 3300031241 Ga0265325_10021987 Ga0265325_100219872 187
893 3300031241 Ga0265325_10072187 Ga0265325_100721872 187
894 3300031344 Ga0265316_10197606 Ga0265316_101976062 187
895 3300031711 Ga0265314_10002967 Ga0265314_1000296717 187
896 3300031711 Ga0265314_10022093 Ga0265314_100220932 187
897 3300033545 Ga0316214_1025086 Ga0316214_10250862 187
898 3300034817 Ga0373948_0024983 Ga0373948_0024983_206_772 187
899 3300035086 Ga0373934_0035489 Ga0373934_0035489_869_1444 187
900 3300035088 Ga0373940_0170900 Ga0373940_0170900_91_657 187
901 3300035089 Ga0373944_0075397 Ga0373944_0075397_54_629 187
902 3300035112 Ga0373932_0039896 Ga0373932_0039896_249_815 187
903 3300035113 Ga0373936_0068571 Ga0373936_0068571_305_880 187
904 3300035113 Ga0373936_0084815 Ga0373936_0084815_641_1216 187
905 3300035115 Ga0373941_0165355 Ga0373941_0165355_92_661 187
906 3300035116 Ga0373945_0011201 Ga0373945_0011201_223_798 187
907 3300035116 Ga0373945_0149661 Ga0373945_0149661_94_669 187
908 3300035117 Ga0373953_0018713 Ga0373953_0018713_1005_1580 187
909 3300035118 Ga0373954_0038167 Ga0373954_0038167_1065_1640 187
910 3300035120 Ga0373957_0063596 Ga0373957_0063596_715_1290 187
911 3300035170 Ga0373943_0003361 Ga0373943_0003361_5849_6424 187
912 3300035171 Ga0373946_0115928 Ga0373946_0115928_41_616 187
913 3300035172 Ga0373955_0044316 Ga0373955_0044316_532_1107 187
914 3300035172 Ga0373955_0179627 Ga0373955_0179627_660_1235 187
915 3300035410 Ga0373924_0008187 Ga0373924_0008187_2089_2664 187
916 3300035692 Ga0373935_0010998 Ga0373935_0010998_504_1079 187
917 3300035692 Ga0373935_0024085 Ga0373935_0024085_1462_2037 187
918 3300035695 Ga0373927_0000097 Ga0373927_0000097_36755_37330 187
919 3300035695 Ga0373927_0101974 Ga0373927_0101974_41_616 187
920 3300035695 Ga0373927_0235915 Ga0373927_0235915_587_1153 187
921 3300035724 Ga0373933_0008807 Ga0373933_0008807_733_1308 187
922 3300035724 Ga0373933_0175895 Ga0373933_0175895_260_835 187
923 3300035724 Ga0373933_0517863 Ga0373933_0517863_128_703 187
924 3300035725 Ga0373947_0000273 Ga0373947_0000273_9589_10164 187
925 3300035725 Ga0373947_0103524 Ga0373947_0103524_614_1189 187
926 3300036401 Ga0373937_0023853 Ga0373937_0023853_110_685 187
927 3300036401 Ga0373937_0057487 Ga0373937_0057487_837_1412 187
928 3300036401 Ga0373937_0430781 Ga0373937_0430781_164_739 187
929 3300036401 Ga0373937_0519497 Ga0373937_0519497_350_916 187
930 3300037068 Ga0373925_0007055 Ga0373925_0007055_5537_6112 187
931 3300037068 Ga0373925_0168463 Ga0373925_0168463_1008_1574 187
932 3300044706 Ga0466964_0350797 Ga0466964_0350797_158_733 187
933 3300044712 Ga0453684_0312454 Ga0453684_0312454_67_630 187
934 3300045051 Ga0451576_0613687 Ga0451576_0613687_91_657 187
935 3300045976 Ga0466967_0446093 Ga0466967_0446093_408_983 187
936 3300046459 Ga0495629_0062294 Ga0495629_0062294_1780_2355 187
937 3300046472 Ga0495580_0000390 Ga0495580_0000390_16171_16746 187
938 3300046472 Ga0495580_0000632 Ga0495580_0000632_16896_17465 187
939 3300046472 Ga0495580_0003018 Ga0495580_0003018_8069_8635 187
940 3300046472 Ga0495580_0038873 Ga0495580_0038873_468_1037 187
941 3300046472 Ga0495580_0182290 Ga0495580_0182290_348_917 187
942 3300046472 Ga0495580_0182775 Ga0495580_0182775_387_962 187
943 3300046472 Ga0495580_0292271 Ga0495580_0292271_247_813 187
944 3300046473 Ga0495582_0116590 Ga0495582_0116590_437_1012 187
945 3300046476 Ga0495662_0178004 Ga0495662_0178004_116_691 187
946 3300046477 Ga0495664_0042440 Ga0495664_0042440_1882_2457 187
947 3300046516 Ga0495628_0170727 Ga0495628_0170727_184_759 187
948 3300046516 Ga0495628_0251890 Ga0495628_0251890_442_1017 187
949 3300046517 Ga0495630_0032613 Ga0495630_0032613_2270_2845 187
950 3300046517 Ga0495630_0773224 Ga0495630_0773224_128_703 187
951 3300046529 Ga0495652_0183427 Ga0495652_0183427_32_607 187
952 3300046543 Ga0495645_0063479 Ga0495645_0063479_1877_2452 187
953 3300046642 Ga0495634_0448689 Ga0495634_0448689_98_673 187
954 3300046664 Ga0495659_0134217 Ga0495659_0134217_134_703 187
955 3300046678 Ga0495599_0206136 Ga0495599_0206136_64_639 187
956 3300046683 Ga0495658_0008453 Ga0495658_0008453_2806_3381 187
957 3300046689 Ga0495613_0262864 Ga0495613_0262864_547_1122 187
958 3300047319 Ga0495674_0016019 Ga0495674_0016019_2694_3269 187
959 3300047319 Ga0495674_0337862 Ga0495674_0337862_531_1106 187
960 3300047321 Ga0495676_0198784 Ga0495676_0198784_677_1252 187
961 3300047321 Ga0495676_0426488 Ga0495676_0426488_204_770 187
962 3300048088 Ga0495602_0095210 Ga0495602_0095210_1270_1845 187
963 3300048903 Ga0496100_0119274 Ga0496100_0119274_48_614 187
964 3300048903 Ga0496100_0233714 Ga0496100_0233714_380_955 187
965 3300048903 Ga0496100_0344815 Ga0496100_0344815_493_1059 187
966 3300048904 Ga0496101_0038805 Ga0496101_0038805_585_1148 187
967 3300048904 Ga0496101_0117394 Ga0496101_0117394_477_1052 187
968 3300048904 Ga0496101_0309521 Ga0496101_0309521_454_1020 187
969 3300048905 Ga0496102_0010132 Ga0496102_0010132_4518_5084 187
970 3300048905 Ga0496102_0046899 Ga0496102_0046899_2128_2694 187
971 3300048905 Ga0496102_0194099 Ga0496102_0194099_779_1345 187
972 3300048906 Ga0496103_0003667 Ga0496103_0003667_7780_8346 187
973 3300048906 Ga0496103_0114317 Ga0496103_0114317_934_1497 187
974 3300048907 Ga0496104_0064252 Ga0496104_0064252_564_1130 187
975 3300048907 Ga0496104_0093388 Ga0496104_0093388_284_847 187
976 3300048907 Ga0496104_0148251 Ga0496104_0148251_135_701 187
977 3300048907 Ga0496104_0230735 Ga0496104_0230735_487_1062 187
978 3300048907 Ga0496104_0572586 Ga0496104_0572586_406_972 187
979 3300048908 Ga0496105_0219216 Ga0496105_0219216_534_1100 187
980 3300048908 Ga0496105_0265041 Ga0496105_0265041_401_964 187
981 3300048909 Ga0496106_0031873 Ga0496106_0031873_2773_3339 187
982 3300048909 Ga0496106_0089262 Ga0496106_0089262_1404_1970 187
983 3300048909 Ga0496106_0104752 Ga0496106_0104752_53_619 187
984 3300048909 Ga0496106_0372534 Ga0496106_0372534_347_910 187
985 3300048910 Ga0496107_0025905 Ga0496107_0025905_473_1039 187
986 3300048910 Ga0496107_0108449 Ga0496107_0108449_519_1085 187
987 3300048911 Ga0496108_0039842 Ga0496108_0039842_573_1136 187
988 3300048911 Ga0496108_0284098 Ga0496108_0284098_135_701 187
989 3300048911 Ga0496108_0346063 Ga0496108_0346063_524_1090 187
990 3300048911 Ga0496108_0412356 Ga0496108_0412356_213_779 187
991 3300048912 Ga0496109_0055729 Ga0496109_0055729_369_932 187
992 3300048912 Ga0496109_0522454 Ga0496109_0522454_493_1059 187
993 3300048913 Ga0496110_0392830 Ga0496110_0392830_192_755 187
994 3300048914 Ga0496111_0002648 Ga0496111_0002648_2778_3341 187
995 3300048915 Ga0496112_0534070 Ga0496112_0534070_190_756 187
996 3300048915 Ga0496112_0885368 Ga0496112_0885368_154_720 187
997 3300048916 Ga0496113_0053888 Ga0496113_0053888_83_646 187
998 3300048917 Ga0496114_0024403 Ga0496114_0024403_2670_3236 187
999 3300048917 Ga0496114_0056277 Ga0496114_0056277_1236_1811 187
1000 3300048918 Ga0496115_0012647 Ga0496115_0012647_130_705 187
1001 3300048918 Ga0496115_0224682 Ga0496115_0224682_620_1195 187
1002 3300048918 Ga0496115_0344194 Ga0496115_0344194_238_804 187
1003 3300049589 Ga0501073_0514696 Ga0501073_0514696_36_605 187
1004 3300049744 Ga0501083_0285583 Ga0501083_0285583_320_889 187
1005 3300050512 nmdc:mga0n895_1163_c1 nmdc:mga0n895_1163_c1_17420_17986 187
1006 3300050512 nmdc:mga0n895_404245_c1 nmdc:mga0n895_404245_c1_341_907 187
1007 3300050513 nmdc:mga0rr50_457197_c1 nmdc:mga0rr50_457197_c1_461_1027 187
1008 3300050514 nmdc:mga08x19_103183_c1 nmdc:mga08x19_103183_c1_741_1307 187
1009 3300050514 nmdc:mga08x19_3802_c1 nmdc:mga08x19_3802_c1_2465_3031 187
1010 3300050515 nmdc:mga0a205_25343_c1 nmdc:mga0a205_25343_c1_1378_1944 187
1011 3300053077 Ga0495601_0057857 Ga0495601_0057857_1395_1970 187
1012 3300053078 Ga0495612_0098517 Ga0495612_0098517_342_908 187
1013 3300053078 Ga0495612_0250525 Ga0495612_0250525_157_732 187
1014 3300053085 Ga0495619_0190933 Ga0495619_0190933_748_1323 187
1015 3300053085 Ga0495619_0300298 Ga0495619_0300298_145_711 187
1016 3300054114 Ga0501084_0399363 Ga0501084_0399363_52_621 187
1017 3300059490 Ga0587066_010893 Ga0587066_010893_597_1160 187
1018 3300059505 Ga0587083_0014262 Ga0587083_0014262_191_754 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14559

TPR_19

Tetratricopeptide repeat

111

181

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vkj-assembly1.cif.gz_A structure of the soluble domain of the membrane protein tm1634 from thermotoga maritima 0.9658 16 67
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.9544 80 144
4mal-assembly1.cif.gz_A tpr3 of fimv from p. aeruginosa (pao1) 0.9513 18 65
4mbq-assembly2.cif.gz_C tpr3 of fimv from p. aeruginosa (pao1) 0.9414 18 64
4mbq-assembly2.cif.gz_D tpr3 of fimv from p. aeruginosa (pao1) 0.9307 18 65
ID Description Score Start End Superfamily
af_K7MZ97_315_380_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9657 84 144 1.25.40.10
af_I1JZZ0_142_217_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9631 78 143 1.25.40.10
af_A0A0G2K726_580_643_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9616 86 144 1.25.40.10
2avpA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9544 80 144 1.25.40.10
af_A0A0R4IV14_222_289_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.953 83 142 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7X4XTE7-F1-model_v4 Tetratricopeptide repeat protein 0.9733 79 169
AF-A0A657AR11-F1-model_v4 Tetratricopeptide repeat protein 0.9595 79 169
AF-X1BVF4-F1-model_v4 Tetratricopeptide repeat protein 0.9578 82 170
AF-A0A533WPL9-F1-model_v4 Uncharacterized protein 0.955 75 169
AF-A0A3M1MPC9-F1-model_v4 Tetratricopeptide repeat protein 0.9535 79 172

Feature Viewer

pLDDT pTM Quality
85.36 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map