F488308
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1018 | 310 | 1018 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100069319|Ga0070706_1000693192 |
| Length | 208 |
| Sequence | MQDSKESPITKSTGRVLHMAQKPTAKKTVAEDPRYTQALQSYESGLRAMQEHKFDKAKPHFQKVVAGPSKELTDRANVHLNICNQHLERSATTQFKTAEEHFDYAVSLMNIGDYVTAREHLEKLLKQNAKSDYVVYGLAALDCLTGHVEDSLKHLDEALRLNAQLRFQARNDSDFQNLAEDPRFTELLYPDPGAELGAADGLGEEEPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 130 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 132 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 133 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 134 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 210 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 214 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 215 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 227 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 248 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.64 |
| Metatranscriptomes | 2.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.39 |
| Rhizosphere | 93.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_8075501 | 2162886012 | Unclassified | 1162 |
| 2 | JGI24751J29686_10001273 | 3300002459 | Bacteria | 5312 |
| 3 | Ga0058863_11541540 | 3300004799 | Bacteria | 1390 |
| 4 | Ga0058861_11821206 | 3300004800 | Unclassified | 1368 |
| 5 | Ga0058861_11967417 | 3300004800 | Bacteria | 1267 |
| 6 | Ga0058860_11978086 | 3300004801 | Unclassified | 826 |
| 7 | Ga0058862_12820738 | 3300004803 | Bacteria | 1222 |
| 8 | Ga0058862_12834571 | 3300004803 | Unclassified | 1429 |
| 9 | Ga0065712_10086293 | 3300005290 | Bacteria | 2629 |
| 10 | Ga0065715_10236585 | 3300005293 | Bacteria | 1214 |
| 11 | Ga0070658_10069011 | 3300005327 | Bacteria | 2891 |
| 12 | Ga0070676_10004549 | 3300005328 | Bacteria | 7308 |
| 13 | Ga0070676_10105639 | 3300005328 | Bacteria | 1746 |
| 14 | Ga0070683_100011357 | 3300005329 | Bacteria | 7695 |
| 15 | Ga0070683_100056407 | 3300005329 | Unclassified | 3648 |
| 16 | Ga0070683_100073917 | 3300005329 | Bacteria | 3183 |
| 17 | Ga0070683_100109583 | 3300005329 | Bacteria | 2604 |
| 18 | Ga0070690_100006782 | 3300005330 | Bacteria | 6512 |
| 19 | Ga0070690_100042518 | 3300005330 | Bacteria | 2878 |
| 20 | Ga0070690_100149109 | 3300005330 | Bacteria | 1594 |
| 21 | Ga0070670_100008946 | 3300005331 | Bacteria | 8554 |
| 22 | Ga0070670_100055647 | 3300005331 | Bacteria | 3396 |
| 23 | Ga0070670_100116293 | 3300005331 | Bacteria | 2306 |
| 24 | Ga0068869_100029232 | 3300005334 | Unclassified | 3860 |
| 25 | Ga0068869_100038435 | 3300005334 | Unclassified | 3412 |
| 26 | Ga0068869_100089885 | 3300005334 | Bacteria | 2307 |
| 27 | Ga0068869_100173917 | 3300005334 | Bacteria | 1684 |
| 28 | Ga0068869_100244958 | 3300005334 | Bacteria | 1429 |
| 29 | Ga0070666_10010790 | 3300005335 | Bacteria | 5719 |
| 30 | Ga0070666_10054046 | 3300005335 | Bacteria | 2709 |
| 31 | Ga0070666_10265759 | 3300005335 | Unclassified | 1217 |
| 32 | Ga0070680_100106362 | 3300005336 | Bacteria | 2333 |
| 33 | Ga0070680_100235706 | 3300005336 | Bacteria | 1546 |
| 34 | Ga0070682_100012261 | 3300005337 | Bacteria | 4909 |
| 35 | Ga0070682_100016275 | 3300005337 | Bacteria | 4322 |
| 36 | Ga0070682_100060121 | 3300005337 | Unclassified | 2403 |
| 37 | Ga0068868_100037844 | 3300005338 | Unclassified | 3742 |
| 38 | Ga0068868_100040602 | 3300005338 | Bacteria | 3622 |
| 39 | Ga0068868_100057200 | 3300005338 | Unclassified | 3080 |
| 40 | Ga0068868_100083073 | 3300005338 | Unclassified | 2570 |
| 41 | Ga0068868_100090258 | 3300005338 | Bacteria | 2467 |
| 42 | Ga0068868_100175989 | 3300005338 | Bacteria | 1773 |
| 43 | Ga0068868_100272670 | 3300005338 | Bacteria | 1430 |
| 44 | Ga0070660_100015581 | 3300005339 | Bacteria | 5493 |
| 45 | Ga0070660_100019827 | 3300005339 | Unclassified | 4933 |
| 46 | Ga0070660_100068642 | 3300005339 | Bacteria | 2763 |
| 47 | Ga0070689_100040309 | 3300005340 | Unclassified | 3580 |
| 48 | Ga0070689_100438618 | 3300005340 | Unclassified | 1109 |
| 49 | Ga0070691_10107415 | 3300005341 | Bacteria | 1393 |
| 50 | Ga0070687_100001627 | 3300005343 | Bacteria | 8003 |
| 51 | Ga0070661_100007433 | 3300005344 | Bacteria | 7554 |
| 52 | Ga0070661_100022951 | 3300005344 | Bacteria | 4469 |
| 53 | Ga0070661_100282225 | 3300005344 | Bacteria | 1289 |
| 54 | Ga0070661_100433625 | 3300005344 | Unclassified | 1043 |
| 55 | Ga0070661_100546227 | 3300005344 | Unclassified | 932 |
| 56 | Ga0070692_10061273 | 3300005345 | Bacteria | 1983 |
| 57 | Ga0070668_100043770 | 3300005347 | Bacteria | 3433 |
| 58 | Ga0070668_100108119 | 3300005347 | Bacteria | 2211 |
| 59 | Ga0070668_100760337 | 3300005347 | Unclassified | 858 |
| 60 | Ga0070669_100068238 | 3300005353 | Bacteria | 2624 |
| 61 | Ga0070669_100202873 | 3300005353 | Bacteria | 1561 |
| 62 | Ga0070675_100023143 | 3300005354 | Unclassified | 4964 |
| 63 | Ga0070675_100403856 | 3300005354 | Unclassified | 1219 |
| 64 | Ga0070671_100057674 | 3300005355 | Bacteria | 3232 |
| 65 | Ga0070671_100122010 | 3300005355 | Bacteria | 2193 |
| 66 | Ga0070674_100018353 | 3300005356 | Bacteria | 4422 |
| 67 | Ga0070673_100008843 | 3300005364 | Bacteria | 6726 |
| 68 | Ga0070673_100042242 | 3300005364 | Unclassified | 3514 |
| 69 | Ga0070688_100009674 | 3300005365 | Bacteria | 5286 |
| 70 | Ga0070659_100010808 | 3300005366 | Bacteria | 6733 |
| 71 | Ga0070659_100028466 | 3300005366 | Bacteria | 4315 |
| 72 | Ga0070659_100028812 | 3300005366 | Unclassified | 4289 |
| 73 | Ga0070659_100700216 | 3300005366 | Unclassified | 876 |
| 74 | Ga0070667_100018917 | 3300005367 | Bacteria | 5711 |
| 75 | Ga0070667_100241782 | 3300005367 | Bacteria | 1612 |
| 76 | Ga0070667_100741985 | 3300005367 | Unclassified | 910 |
| 77 | Ga0070667_100744516 | 3300005367 | Unclassified | 908 |
| 78 | Ga0070667_100906509 | 3300005367 | Unclassified | 821 |
| 79 | Ga0070709_10003196 | 3300005434 | Bacteria | 8792 |
| 80 | Ga0070709_10023873 | 3300005434 | Unclassified | 3596 |
| 81 | Ga0070709_10033980 | 3300005434 | Bacteria | 3089 |
| 82 | Ga0070709_10070113 | 3300005434 | Bacteria | 2259 |
| 83 | Ga0070709_10508767 | 3300005434 | Unclassified | 916 |
| 84 | Ga0070714_100000801 | 3300005435 | Bacteria | 22250 |
| 85 | Ga0070714_100003775 | 3300005435 | Bacteria | 11364 |
| 86 | Ga0070714_100097891 | 3300005435 | Unclassified | 2580 |
| 87 | Ga0070714_100244840 | 3300005435 | Bacteria | 1656 |
| 88 | Ga0070714_100257715 | 3300005435 | Bacteria | 1614 |
| 89 | Ga0070714_100448607 | 3300005435 | Unclassified | 1225 |
| 90 | Ga0070713_100000569 | 3300005436 | Bacteria | 23377 |
| 91 | Ga0070713_100009328 | 3300005436 | Bacteria | 7016 |
| 92 | Ga0070713_100074368 | 3300005436 | Unclassified | 2878 |
| 93 | Ga0070713_100164175 | 3300005436 | Bacteria | 1985 |
| 94 | Ga0070713_100168656 | 3300005436 | Bacteria | 1959 |
| 95 | Ga0070713_100192372 | 3300005436 | Bacteria | 1839 |
| 96 | Ga0070713_100242057 | 3300005436 | Unclassified | 1643 |
| 97 | Ga0070713_100245534 | 3300005436 | Bacteria | 1631 |
| 98 | Ga0070713_100329561 | 3300005436 | Unclassified | 1412 |
| 99 | Ga0070713_100917487 | 3300005436 | Unclassified | 843 |
| 100 | Ga0070713_101290489 | 3300005436 | Bacteria | 707 |
| 101 | Ga0070710_10010073 | 3300005437 | Bacteria | 4636 |
| 102 | Ga0070710_10021673 | 3300005437 | Bacteria | 3352 |
| 103 | Ga0070710_10029956 | 3300005437 | Bacteria | 2924 |
| 104 | Ga0070710_10082745 | 3300005437 | Unclassified | 1877 |
| 105 | Ga0070710_10262749 | 3300005437 | Bacteria | 1114 |
| 106 | Ga0070711_100003297 | 3300005439 | Bacteria | 9397 |
| 107 | Ga0070711_100006867 | 3300005439 | Bacteria | 6894 |
| 108 | Ga0070711_100030092 | 3300005439 | Bacteria | 3591 |
| 109 | Ga0070711_100174826 | 3300005439 | Bacteria | 1639 |
| 110 | Ga0070711_100256528 | 3300005439 | Bacteria | 1374 |
| 111 | Ga0070711_100281402 | 3300005439 | Bacteria | 1316 |
| 112 | Ga0070711_100798451 | 3300005439 | Unclassified | 800 |
| 113 | Ga0070705_100067854 | 3300005440 | Unclassified | 2144 |
| 114 | Ga0070694_100270029 | 3300005444 | Bacteria | 1293 |
| 115 | Ga0070708_100005568 | 3300005445 | Bacteria | 9979 |
| 116 | Ga0070708_100013578 | 3300005445 | Bacteria | 6675 |
| 117 | Ga0070708_100016686 | 3300005445 | Bacteria | 6101 |
| 118 | Ga0070708_100018605 | 3300005445 | Bacteria | 5815 |
| 119 | Ga0070708_100103449 | 3300005445 | Bacteria | 2610 |
| 120 | Ga0070708_100425606 | 3300005445 | Bacteria | 1252 |
| 121 | Ga0070708_100632224 | 3300005445 | Unclassified | 1009 |
| 122 | Ga0070663_100085535 | 3300005455 | Bacteria | 2327 |
| 123 | Ga0070663_100096309 | 3300005455 | Bacteria | 2201 |
| 124 | Ga0070678_100301407 | 3300005456 | Unclassified | 1362 |
| 125 | Ga0070678_100677526 | 3300005456 | Bacteria | 927 |
| 126 | Ga0070662_100001509 | 3300005457 | Bacteria | 14305 |
| 127 | Ga0070662_100016025 | 3300005457 | Bacteria | 5029 |
| 128 | Ga0070662_100606752 | 3300005457 | Unclassified | 921 |
| 129 | Ga0070681_10000026 | 3300005458 | Bacteria | 107615 |
| 130 | Ga0070681_10003878 | 3300005458 | Bacteria | 14076 |
| 131 | Ga0070681_10024591 | 3300005458 | Bacteria | 6059 |
| 132 | Ga0070681_10072813 | 3300005458 | Bacteria | 3398 |
| 133 | Ga0070681_10074313 | 3300005458 | Bacteria | 3360 |
| 134 | Ga0070681_10101548 | 3300005458 | Bacteria | 2822 |
| 135 | Ga0070681_10424738 | 3300005458 | Bacteria | 1241 |
| 136 | Ga0068867_100018978 | 3300005459 | Unclassified | 4895 |
| 137 | Ga0068867_100026637 | 3300005459 | Unclassified | 4152 |
| 138 | Ga0068867_100061067 | 3300005459 | Bacteria | 2797 |
| 139 | Ga0070685_10000797 | 3300005466 | Bacteria | 17094 |
| 140 | Ga0070685_10066079 | 3300005466 | Bacteria | 2130 |
| 141 | Ga0070706_100000454 | 3300005467 | Bacteria | 48917 |
| 142 | Ga0070706_100002171 | 3300005467 | Bacteria | 19943 |
| 143 | Ga0070706_100033498 | 3300005467 | Bacteria | 4741 |
| 144 | Ga0070706_100069319 | 3300005467 | Bacteria | 3262 |
| 145 | Ga0070706_100089643 | 3300005467 | Bacteria | 2852 |
| 146 | Ga0070706_100102492 | 3300005467 | Bacteria | 2661 |
| 147 | Ga0070707_100001443 | 3300005468 | Bacteria | 23285 |
| 148 | Ga0070707_100010916 | 3300005468 | Bacteria | 8458 |
| 149 | Ga0070707_100031745 | 3300005468 | Bacteria | 5032 |
| 150 | Ga0070707_100053245 | 3300005468 | Bacteria | 3879 |
| 151 | Ga0070707_100300742 | 3300005468 | Bacteria | 1559 |
| 152 | Ga0070707_100309713 | 3300005468 | Unclassified | 1535 |
| 153 | Ga0070707_101027885 | 3300005468 | Unclassified | 789 |
| 154 | Ga0070698_100000216 | 3300005471 | Bacteria | 56257 |
| 155 | Ga0070698_100161985 | 3300005471 | Bacteria | 2181 |
| 156 | Ga0070698_100833582 | 3300005471 | Unclassified | 867 |
| 157 | Ga0070699_100017274 | 3300005518 | Bacteria | 6195 |
| 158 | Ga0070679_100012185 | 3300005530 | Bacteria | 8212 |
| 159 | Ga0070679_100028646 | 3300005530 | Bacteria | 5492 |
| 160 | Ga0070679_100051762 | 3300005530 | Unclassified | 4090 |
| 161 | Ga0070679_100070772 | 3300005530 | Bacteria | 3480 |
| 162 | Ga0070679_100103365 | 3300005530 | Bacteria | 2835 |
| 163 | Ga0070679_100474383 | 3300005530 | Unclassified | 1195 |
| 164 | Ga0070684_100004113 | 3300005535 | Bacteria | 11006 |
| 165 | Ga0070684_100036867 | 3300005535 | Bacteria | 4192 |
| 166 | Ga0070684_100069961 | 3300005535 | Unclassified | 3087 |
| 167 | Ga0070684_100121704 | 3300005535 | Unclassified | 2348 |
| 168 | Ga0070684_100132654 | 3300005535 | Bacteria | 2247 |
| 169 | Ga0070697_100001523 | 3300005536 | Bacteria | 17629 |
| 170 | Ga0070697_100055246 | 3300005536 | Bacteria | 3228 |
| 171 | Ga0070697_100092384 | 3300005536 | Unclassified | 2504 |
| 172 | Ga0070697_100199755 | 3300005536 | Unclassified | 1699 |
| 173 | Ga0070697_100380771 | 3300005536 | Bacteria | 1222 |
| 174 | Ga0070697_100562381 | 3300005536 | Bacteria | 1000 |
| 175 | Ga0070697_100637354 | 3300005536 | Unclassified | 938 |
| 176 | Ga0070697_100642296 | 3300005536 | Bacteria | 934 |
| 177 | Ga0068853_100006912 | 3300005539 | Bacteria | 9059 |
| 178 | Ga0068853_100012490 | 3300005539 | Bacteria | 6909 |
| 179 | Ga0068853_100040217 | 3300005539 | Bacteria | 3988 |
| 180 | Ga0068853_100064187 | 3300005539 | Bacteria | 3183 |
| 181 | Ga0068853_100077536 | 3300005539 | Bacteria | 2903 |
| 182 | Ga0068853_100118454 | 3300005539 | Unclassified | 2360 |
| 183 | Ga0068853_100317779 | 3300005539 | Bacteria | 1443 |
| 184 | Ga0070672_100048312 | 3300005543 | Bacteria | 3306 |
| 185 | Ga0070672_100572206 | 3300005543 | Unclassified | 982 |
| 186 | Ga0070686_100010765 | 3300005544 | Bacteria | 5171 |
| 187 | Ga0070695_100013438 | 3300005545 | Bacteria | 4920 |
| 188 | Ga0070695_100210979 | 3300005545 | Unclassified | 1394 |
| 189 | Ga0070696_100168212 | 3300005546 | Bacteria | 1619 |
| 190 | Ga0070696_100335292 | 3300005546 | Bacteria | 1167 |
| 191 | Ga0070693_100009042 | 3300005547 | Bacteria | 4943 |
| 192 | Ga0070693_100072316 | 3300005547 | Bacteria | 2034 |
| 193 | Ga0070693_100441959 | 3300005547 | Bacteria | 911 |
| 194 | Ga0070693_100841538 | 3300005547 | Unclassified | 683 |
| 195 | Ga0070665_100050113 | 3300005548 | Bacteria | 4190 |
| 196 | Ga0070665_100429110 | 3300005548 | Unclassified | 1331 |
| 197 | Ga0070704_100461517 | 3300005549 | Unclassified | 1096 |
| 198 | Ga0068855_100000295 | 3300005563 | Bacteria | 61909 |
| 199 | Ga0068855_100018006 | 3300005563 | Bacteria | 8488 |
| 200 | Ga0068855_100043827 | 3300005563 | Bacteria | 5297 |
| 201 | Ga0068855_100054917 | 3300005563 | Unclassified | 4680 |
| 202 | Ga0068855_100139353 | 3300005563 | Unclassified | 2766 |
| 203 | Ga0068855_100166960 | 3300005563 | Bacteria | 2494 |
| 204 | Ga0068855_100222675 | 3300005563 | Unclassified | 2115 |
| 205 | Ga0068855_100373419 | 3300005563 | Unclassified | 1567 |
| 206 | Ga0068855_100398673 | 3300005563 | Bacteria | 1508 |
| 207 | Ga0070664_100000687 | 3300005564 | Bacteria | 25824 |
| 208 | Ga0070664_100018900 | 3300005564 | Bacteria | 5666 |
| 209 | Ga0070664_100049580 | 3300005564 | Bacteria | 3551 |
| 210 | Ga0070664_100266771 | 3300005564 | Bacteria | 1541 |
| 211 | Ga0070664_100493833 | 3300005564 | Unclassified | 1128 |
| 212 | Ga0068857_100001872 | 3300005577 | Bacteria | 16933 |
| 213 | Ga0068857_100002428 | 3300005577 | Bacteria | 15213 |
| 214 | Ga0068857_100010663 | 3300005577 | Bacteria | 7994 |
| 215 | Ga0068857_100056730 | 3300005577 | Bacteria | 3476 |
| 216 | Ga0068857_100202557 | 3300005577 | Bacteria | 1809 |
| 217 | Ga0068857_100286927 | 3300005577 | Bacteria | 1515 |
| 218 | Ga0068854_100023329 | 3300005578 | Unclassified | 4225 |
| 219 | Ga0068854_100028511 | 3300005578 | Bacteria | 3858 |
| 220 | Ga0068854_100050952 | 3300005578 | Unclassified | 2964 |
| 221 | Ga0068854_100089977 | 3300005578 | Bacteria | 2282 |
| 222 | Ga0068854_100161548 | 3300005578 | Bacteria | 1735 |
| 223 | Ga0068854_100754427 | 3300005578 | Unclassified | 844 |
| 224 | Ga0068856_100000407 | 3300005614 | Bacteria | 47326 |
| 225 | Ga0068856_100000574 | 3300005614 | Bacteria | 40092 |
| 226 | Ga0068856_100002064 | 3300005614 | Bacteria | 20820 |
| 227 | Ga0068856_100006032 | 3300005614 | Bacteria | 11919 |
| 228 | Ga0068856_100009749 | 3300005614 | Bacteria | 9330 |
| 229 | Ga0068856_100048394 | 3300005614 | Bacteria | 4189 |
| 230 | Ga0068856_100106639 | 3300005614 | Bacteria | 2797 |
| 231 | Ga0068856_100193997 | 3300005614 | Bacteria | 2045 |
| 232 | Ga0068856_100307703 | 3300005614 | Unclassified | 1602 |
| 233 | Ga0068856_100456165 | 3300005614 | Unclassified | 1299 |
| 234 | Ga0068852_100007670 | 3300005616 | Bacteria | 7894 |
| 235 | Ga0068852_100097203 | 3300005616 | Unclassified | 2648 |
| 236 | Ga0068852_100116779 | 3300005616 | Bacteria | 2435 |
| 237 | Ga0068852_100163911 | 3300005616 | Unclassified | 2078 |
| 238 | Ga0068852_100180529 | 3300005616 | Bacteria | 1984 |
| 239 | Ga0068852_100319699 | 3300005616 | Unclassified | 1507 |
| 240 | Ga0068852_100528851 | 3300005616 | Bacteria | 1177 |
| 241 | Ga0068859_100015249 | 3300005617 | Bacteria | 7717 |
| 242 | Ga0068859_100039953 | 3300005617 | Unclassified | 4709 |
| 243 | Ga0068864_100000684 | 3300005618 | Bacteria | 28437 |
| 244 | Ga0068864_100079900 | 3300005618 | Unclassified | 2864 |
| 245 | Ga0068864_100271583 | 3300005618 | Bacteria | 1580 |
| 246 | Ga0068866_10016537 | 3300005718 | Bacteria | 3299 |
| 247 | Ga0068866_10021658 | 3300005718 | Bacteria | 2964 |
| 248 | Ga0068866_10021829 | 3300005718 | Unclassified | 2954 |
| 249 | Ga0068866_10022138 | 3300005718 | Unclassified | 2938 |
| 250 | Ga0068861_100061273 | 3300005719 | Bacteria | 2887 |
| 251 | Ga0068851_10007945 | 3300005834 | Bacteria | 4891 |
| 252 | Ga0068851_10032375 | 3300005834 | Bacteria | 2602 |
| 253 | Ga0068870_10014885 | 3300005840 | Bacteria | 3683 |
| 254 | Ga0068870_10037683 | 3300005840 | Unclassified | 2493 |
| 255 | Ga0068863_100012509 | 3300005841 | Bacteria | 8191 |
| 256 | Ga0068863_100038509 | 3300005841 | Bacteria | 4549 |
| 257 | Ga0068863_100056594 | 3300005841 | Bacteria | 3712 |
| 258 | Ga0068863_100058737 | 3300005841 | Bacteria | 3640 |
| 259 | Ga0068863_100178505 | 3300005841 | Bacteria | 2038 |
| 260 | Ga0068863_100186987 | 3300005841 | Bacteria | 1990 |
| 261 | Ga0068858_100003346 | 3300005842 | Bacteria | 15959 |
| 262 | Ga0068858_100009627 | 3300005842 | Bacteria | 9210 |
| 263 | Ga0068858_100026465 | 3300005842 | Bacteria | 5388 |
| 264 | Ga0068858_100197436 | 3300005842 | Bacteria | 1902 |
| 265 | Ga0068858_100233188 | 3300005842 | Bacteria | 1745 |
| 266 | Ga0068858_100702272 | 3300005842 | Unclassified | 984 |
| 267 | Ga0068860_100024585 | 3300005843 | Bacteria | 5818 |
| 268 | Ga0068860_100035179 | 3300005843 | Unclassified | 4806 |
| 269 | Ga0068860_100040235 | 3300005843 | Bacteria | 4469 |
| 270 | Ga0068860_100060161 | 3300005843 | Bacteria | 3610 |
| 271 | Ga0068862_100089621 | 3300005844 | Bacteria | 2677 |
| 272 | Ga0068862_100154125 | 3300005844 | Unclassified | 2047 |
| 273 | Ga0068862_100215943 | 3300005844 | Bacteria | 1735 |
| 274 | Ga0081540_1060056 | 3300005983 | Unclassified | 1821 |
| 275 | Ga0081540_1079668 | 3300005983 | Bacteria | 1480 |
| 276 | Ga0070717_10016710 | 3300006028 | Bacteria | 5696 |
| 277 | Ga0070717_10019684 | 3300006028 | Bacteria | 5298 |
| 278 | Ga0070717_10022998 | 3300006028 | Bacteria | 4932 |
| 279 | Ga0070717_10039792 | 3300006028 | Bacteria | 3826 |
| 280 | Ga0070717_10191634 | 3300006028 | Unclassified | 1786 |
| 281 | Ga0070717_10202152 | 3300006028 | Bacteria | 1741 |
| 282 | Ga0070717_10329442 | 3300006028 | Bacteria | 1362 |
| 283 | Ga0070717_10406145 | 3300006028 | Bacteria | 1224 |
| 284 | Ga0070717_10473219 | 3300006028 | Bacteria | 1131 |
| 285 | Ga0070717_10974984 | 3300006028 | Bacteria | 772 |
| 286 | Ga0070715_10020920 | 3300006163 | Unclassified | 2530 |
| 287 | Ga0070715_10033486 | 3300006163 | Unclassified | 2100 |
| 288 | Ga0070715_10054611 | 3300006163 | Unclassified | 1731 |
| 289 | Ga0070715_10131266 | 3300006163 | Bacteria | 1206 |
| 290 | Ga0070716_100000426 | 3300006173 | Bacteria | 17432 |
| 291 | Ga0070716_100009551 | 3300006173 | Unclassified | 4836 |
| 292 | Ga0070716_100013373 | 3300006173 | Bacteria | 4181 |
| 293 | Ga0070716_100031549 | 3300006173 | Bacteria | 2882 |
| 294 | Ga0070716_100035419 | 3300006173 | Bacteria | 2744 |
| 295 | Ga0070716_100039461 | 3300006173 | Unclassified | 2621 |
| 296 | Ga0070716_100040899 | 3300006173 | Bacteria | 2580 |
| 297 | Ga0070716_100042771 | 3300006173 | Bacteria | 2530 |
| 298 | Ga0070716_100291271 | 3300006173 | Bacteria | 1131 |
| 299 | Ga0070716_100341712 | 3300006173 | Unclassified | 1056 |
| 300 | Ga0070712_100000375 | 3300006175 | Bacteria | 25335 |
| 301 | Ga0070712_100000708 | 3300006175 | Bacteria | 19645 |
| 302 | Ga0070712_100000952 | 3300006175 | Bacteria | 17401 |
| 303 | Ga0070712_100001820 | 3300006175 | Bacteria | 12980 |
| 304 | Ga0070712_100089564 | 3300006175 | Bacteria | 2251 |
| 305 | Ga0070712_100153506 | 3300006175 | Bacteria | 1770 |
| 306 | Ga0070712_100173881 | 3300006175 | Unclassified | 1673 |
| 307 | Ga0070712_100884971 | 3300006175 | Bacteria | 769 |
| 308 | Ga0070712_100996098 | 3300006175 | Unclassified | 725 |
| 309 | Ga0097621_100000237 | 3300006237 | Bacteria | 37036 |
| 310 | Ga0097621_100078861 | 3300006237 | Bacteria | 2736 |
| 311 | Ga0097621_100131172 | 3300006237 | Bacteria | 2133 |
| 312 | Ga0097621_100138738 | 3300006237 | Bacteria | 2076 |
| 313 | Ga0097621_100292498 | 3300006237 | Bacteria | 1436 |
| 314 | Ga0068871_100001254 | 3300006358 | Bacteria | 16960 |
| 315 | Ga0068871_100003099 | 3300006358 | Bacteria | 11410 |
| 316 | Ga0068871_100017377 | 3300006358 | Bacteria | 5442 |
| 317 | Ga0068871_100025052 | 3300006358 | Bacteria | 4636 |
| 318 | Ga0068871_100125464 | 3300006358 | Unclassified | 2172 |
| 319 | Ga0068871_100199812 | 3300006358 | Bacteria | 1725 |
| 320 | Ga0068871_100254468 | 3300006358 | Unclassified | 1530 |
| 321 | Ga0068871_100361836 | 3300006358 | Bacteria | 1285 |
| 322 | Ga0075433_10020011 | 3300006852 | Bacteria | 5590 |
| 323 | Ga0075433_10067212 | 3300006852 | Unclassified | 3146 |
| 324 | Ga0075433_10474415 | 3300006852 | Bacteria | 1102 |
| 325 | Ga0075434_100000460 | 3300006871 | Bacteria | 30424 |
| 326 | Ga0075434_100003658 | 3300006871 | Bacteria | 13733 |
| 327 | Ga0075434_100039922 | 3300006871 | Bacteria | 4648 |
| 328 | Ga0068865_100008049 | 3300006881 | Bacteria | 6508 |
| 329 | Ga0068865_100024968 | 3300006881 | Unclassified | 3926 |
| 330 | Ga0068865_100134911 | 3300006881 | Bacteria | 1853 |
| 331 | Ga0068865_100385278 | 3300006881 | Bacteria | 1144 |
| 332 | Ga0068865_100527383 | 3300006881 | Unclassified | 988 |
| 333 | Ga0075436_100002468 | 3300006914 | Bacteria | 12728 |
| 334 | Ga0075436_100010225 | 3300006914 | Bacteria | 6425 |
| 335 | Ga0075436_100164013 | 3300006914 | Bacteria | 1567 |
| 336 | Ga0097620_100015248 | 3300006931 | Bacteria | 7717 |
| 337 | Ga0097620_100039953 | 3300006931 | Unclassified | 4709 |
| 338 | Ga0075435_100000141 | 3300007076 | Bacteria | 40680 |
| 339 | Ga0075435_100052825 | 3300007076 | Bacteria | 3275 |
| 340 | Ga0075435_100321593 | 3300007076 | Bacteria | 1324 |
| 341 | Ga0099794_10130754 | 3300007265 | Bacteria | 1267 |
| 342 | Ga0105251_10187492 | 3300009011 | Bacteria | 931 |
| 343 | Ga0105250_10103101 | 3300009092 | Unclassified | 1165 |
| 344 | Ga0105250_10122046 | 3300009092 | Bacteria | 1072 |
| 345 | Ga0105240_10007038 | 3300009093 | Bacteria | 16411 |
| 346 | Ga0105240_10023147 | 3300009093 | Bacteria | 8225 |
| 347 | Ga0105240_10063883 | 3300009093 | Unclassified | 4577 |
| 348 | Ga0105240_10078754 | 3300009093 | Bacteria | 4057 |
| 349 | Ga0105240_10088126 | 3300009093 | Bacteria | 3799 |
| 350 | Ga0105240_10287080 | 3300009093 | Bacteria | 1888 |
| 351 | Ga0105240_10331301 | 3300009093 | Bacteria | 1732 |
| 352 | Ga0105240_11125776 | 3300009093 | Unclassified | 834 |
| 353 | Ga0111539_10415590 | 3300009094 | Bacteria | 1567 |
| 354 | Ga0105245_10059246 | 3300009098 | Bacteria | 3448 |
| 355 | Ga0105245_10062536 | 3300009098 | Bacteria | 3359 |
| 356 | Ga0105245_10070411 | 3300009098 | Bacteria | 3173 |
| 357 | Ga0105245_10322498 | 3300009098 | Unclassified | 1522 |
| 358 | Ga0105247_10001613 | 3300009101 | Bacteria | 15966 |
| 359 | Ga0105247_10025257 | 3300009101 | Unclassified | 3584 |
| 360 | Ga0105247_10038216 | 3300009101 | Bacteria | 2929 |
| 361 | Ga0105247_10766230 | 3300009101 | Unclassified | 733 |
| 362 | Ga0105243_10295434 | 3300009148 | Bacteria | 1466 |
| 363 | Ga0105243_10858585 | 3300009148 | Bacteria | 899 |
| 364 | Ga0105243_11132394 | 3300009148 | Unclassified | 792 |
| 365 | Ga0105241_10000910 | 3300009174 | Bacteria | 22369 |
| 366 | Ga0105241_10023344 | 3300009174 | Unclassified | 4586 |
| 367 | Ga0105241_10026676 | 3300009174 | Bacteria | 4300 |
| 368 | Ga0105241_10034557 | 3300009174 | Bacteria | 3799 |
| 369 | Ga0105241_10050807 | 3300009174 | Bacteria | 3160 |
| 370 | Ga0105241_10085581 | 3300009174 | Bacteria | 2478 |
| 371 | Ga0105241_10086055 | 3300009174 | Bacteria | 2471 |
| 372 | Ga0105241_10122990 | 3300009174 | Unclassified | 2092 |
| 373 | Ga0105241_10218798 | 3300009174 | Bacteria | 1599 |
| 374 | Ga0105241_10258244 | 3300009174 | Unclassified | 1480 |
| 375 | Ga0105241_10429685 | 3300009174 | Bacteria | 1164 |
| 376 | Ga0105242_10045283 | 3300009176 | Bacteria | 3565 |
| 377 | Ga0105242_10081210 | 3300009176 | Bacteria | 2711 |
| 378 | Ga0105242_10498187 | 3300009176 | Unclassified | 1158 |
| 379 | Ga0105242_11054714 | 3300009176 | Unclassified | 824 |
| 380 | Ga0105248_10013380 | 3300009177 | Bacteria | 9031 |
| 381 | Ga0105248_10023146 | 3300009177 | Bacteria | 6900 |
| 382 | Ga0105248_10077736 | 3300009177 | Unclassified | 3731 |
| 383 | Ga0105248_10111178 | 3300009177 | Unclassified | 3090 |
| 384 | Ga0105248_10119859 | 3300009177 | Bacteria | 2968 |
| 385 | Ga0105248_10168518 | 3300009177 | Unclassified | 2468 |
| 386 | Ga0105248_10344950 | 3300009177 | Bacteria | 1676 |
| 387 | Ga0105248_10734650 | 3300009177 | Unclassified | 1114 |
| 388 | Ga0105237_10021829 | 3300009545 | Bacteria | 6576 |
| 389 | Ga0105237_10022977 | 3300009545 | Bacteria | 6395 |
| 390 | Ga0105237_10299535 | 3300009545 | Unclassified | 1611 |
| 391 | Ga0105237_11027503 | 3300009545 | Bacteria | 831 |
| 392 | Ga0105237_11498039 | 3300009545 | Unclassified | 681 |
| 393 | Ga0105238_10000188 | 3300009551 | Bacteria | 68217 |
| 394 | Ga0105238_10016920 | 3300009551 | Bacteria | 7400 |
| 395 | Ga0105238_10023454 | 3300009551 | Bacteria | 6290 |
| 396 | Ga0105238_10037684 | 3300009551 | Bacteria | 4914 |
| 397 | Ga0105238_10055918 | 3300009551 | Bacteria | 3959 |
| 398 | Ga0105249_10006286 | 3300009553 | Bacteria | 10317 |
| 399 | Ga0105249_10025448 | 3300009553 | Bacteria | 5328 |
| 400 | Ga0105249_10034638 | 3300009553 | Bacteria | 4576 |
| 401 | Ga0105249_10961789 | 3300009553 | Unclassified | 922 |
| 402 | Ga0105239_10009528 | 3300010375 | Bacteria | 10931 |
| 403 | Ga0105239_10059067 | 3300010375 | Bacteria | 4209 |
| 404 | Ga0105239_10080930 | 3300010375 | Bacteria | 3574 |
| 405 | Ga0105239_10373781 | 3300010375 | Unclassified | 1611 |
| 406 | Ga0105246_10065236 | 3300011119 | Bacteria | 2546 |
| 407 | Ga0105246_10091932 | 3300011119 | Bacteria | 2188 |
| 408 | Ga0157324_1013069 | 3300012506 | Unclassified | 745 |
| 409 | Ga0157373_10001291 | 3300013100 | Bacteria | 19116 |
| 410 | Ga0157373_10013739 | 3300013100 | Bacteria | 5936 |
| 411 | Ga0157373_10032458 | 3300013100 | Bacteria | 3759 |
| 412 | Ga0157373_10106830 | 3300013100 | Bacteria | 1968 |
| 413 | Ga0157373_10130589 | 3300013100 | Unclassified | 1767 |
| 414 | Ga0157373_10135455 | 3300013100 | Unclassified | 1732 |
| 415 | Ga0157373_10189097 | 3300013100 | Unclassified | 1451 |
| 416 | Ga0157371_10010976 | 3300013102 | Bacteria | 7020 |
| 417 | Ga0157371_10185360 | 3300013102 | Bacteria | 1489 |
| 418 | Ga0157371_10405826 | 3300013102 | Unclassified | 997 |
| 419 | Ga0157371_10603082 | 3300013102 | Unclassified | 817 |
| 420 | Ga0157370_10011537 | 3300013104 | Bacteria | 9228 |
| 421 | Ga0157370_10025983 | 3300013104 | Bacteria | 5787 |
| 422 | Ga0157370_10297528 | 3300013104 | Unclassified | 1490 |
| 423 | Ga0157369_10000124 | 3300013105 | Bacteria | 110693 |
| 424 | Ga0157369_10013546 | 3300013105 | Bacteria | 9217 |
| 425 | Ga0157369_10026095 | 3300013105 | Bacteria | 6482 |
| 426 | Ga0157369_10030134 | 3300013105 | Bacteria | 5986 |
| 427 | Ga0157369_10059396 | 3300013105 | Bacteria | 4123 |
| 428 | Ga0157369_10115306 | 3300013105 | Unclassified | 2853 |
| 429 | Ga0157369_10250963 | 3300013105 | Bacteria | 1847 |
| 430 | Ga0157374_10000162 | 3300013296 | Bacteria | 61913 |
| 431 | Ga0157374_10000582 | 3300013296 | Bacteria | 32362 |
| 432 | Ga0157374_10002038 | 3300013296 | Bacteria | 16970 |
| 433 | Ga0157374_10007625 | 3300013296 | Bacteria | 9238 |
| 434 | Ga0157374_10022134 | 3300013296 | Bacteria | 5667 |
| 435 | Ga0157374_10053221 | 3300013296 | Unclassified | 3773 |
| 436 | Ga0157374_10072470 | 3300013296 | Bacteria | 3250 |
| 437 | Ga0157374_10239140 | 3300013296 | Bacteria | 1785 |
| 438 | Ga0157374_10311953 | 3300013296 | Bacteria | 1557 |
| 439 | Ga0157374_10531583 | 3300013296 | Unclassified | 1182 |
| 440 | Ga0157374_11442313 | 3300013296 | Bacteria | 711 |
| 441 | Ga0157378_10000020 | 3300013297 | Bacteria | 131245 |
| 442 | Ga0157378_10000320 | 3300013297 | Bacteria | 47177 |
| 443 | Ga0157378_10003732 | 3300013297 | Bacteria | 13503 |
| 444 | Ga0157378_10053001 | 3300013297 | Unclassified | 3611 |
| 445 | Ga0157378_10169006 | 3300013297 | Bacteria | 2049 |
| 446 | Ga0157378_10567007 | 3300013297 | Unclassified | 1143 |
| 447 | Ga0157378_10859808 | 3300013297 | Unclassified | 936 |
| 448 | Ga0157378_11095831 | 3300013297 | Unclassified | 833 |
| 449 | Ga0163162_10001366 | 3300013306 | Bacteria | 22706 |
| 450 | Ga0163162_10004521 | 3300013306 | Bacteria | 13394 |
| 451 | Ga0163162_10018901 | 3300013306 | Bacteria | 6757 |
| 452 | Ga0163162_10088580 | 3300013306 | Bacteria | 3174 |
| 453 | Ga0163162_10425830 | 3300013306 | Bacteria | 1459 |
| 454 | Ga0163162_10469048 | 3300013306 | Bacteria | 1390 |
| 455 | Ga0157372_10000084 | 3300013307 | Bacteria | 98431 |
| 456 | Ga0157372_10001092 | 3300013307 | Bacteria | 29537 |
| 457 | Ga0157372_10001112 | 3300013307 | Bacteria | 29221 |
| 458 | Ga0157372_10007677 | 3300013307 | Bacteria | 11475 |
| 459 | Ga0157372_10030884 | 3300013307 | Bacteria | 5863 |
| 460 | Ga0157372_10035192 | 3300013307 | Bacteria | 5511 |
| 461 | Ga0157372_10052890 | 3300013307 | Bacteria | 4524 |
| 462 | Ga0157372_10055764 | 3300013307 | Unclassified | 4414 |
| 463 | Ga0157372_10148560 | 3300013307 | Bacteria | 2703 |
| 464 | Ga0157372_10212864 | 3300013307 | Unclassified | 2240 |
| 465 | Ga0157372_10340278 | 3300013307 | Bacteria | 1747 |
| 466 | Ga0157372_10429140 | 3300013307 | Bacteria | 1540 |
| 467 | Ga0157375_10039878 | 3300013308 | Bacteria | 4522 |
| 468 | Ga0157375_10100161 | 3300013308 | Unclassified | 2977 |
| 469 | Ga0163163_10005648 | 3300014325 | Bacteria | 10842 |
| 470 | Ga0163163_10191042 | 3300014325 | Unclassified | 2096 |
| 471 | Ga0163163_10607816 | 3300014325 | Bacteria | 1157 |
| 472 | Ga0157380_10017537 | 3300014326 | Bacteria | 5300 |
| 473 | Ga0182008_10008926 | 3300014497 | Bacteria | 5437 |
| 474 | Ga0182008_10075420 | 3300014497 | Unclassified | 1659 |
| 475 | Ga0157377_10000230 | 3300014745 | Bacteria | 29235 |
| 476 | Ga0157379_10008716 | 3300014968 | Bacteria | 8838 |
| 477 | Ga0157379_10017268 | 3300014968 | Bacteria | 6357 |
| 478 | Ga0157379_10033479 | 3300014968 | Bacteria | 4582 |
| 479 | Ga0157379_10088166 | 3300014968 | Bacteria | 2782 |
| 480 | Ga0157379_10117922 | 3300014968 | Unclassified | 2388 |
| 481 | Ga0157379_10462791 | 3300014968 | Unclassified | 1172 |
| 482 | Ga0157376_10001784 | 3300014969 | Bacteria | 14330 |
| 483 | Ga0157376_10001794 | 3300014969 | Bacteria | 14277 |
| 484 | Ga0157376_10031533 | 3300014969 | Bacteria | 4246 |
| 485 | Ga0157376_10049823 | 3300014969 | Bacteria | 3471 |
| 486 | Ga0157376_10096542 | 3300014969 | Bacteria | 2572 |
| 487 | Ga0157376_10127883 | 3300014969 | Unclassified | 2263 |
| 488 | Ga0157376_10257624 | 3300014969 | Bacteria | 1632 |
| 489 | Ga0182006_1109024 | 3300015261 | Unclassified | 974 |
| 490 | Ga0182007_10034176 | 3300015262 | Unclassified | 1719 |
| 491 | Ga0182007_10053490 | 3300015262 | Bacteria | 1329 |
| 492 | Ga0182005_1038296 | 3300015265 | Bacteria | 1304 |
| 493 | Ga0163161_10012941 | 3300017792 | Bacteria | 5796 |
| 494 | Ga0206350_10675980 | 3300020080 | Unclassified | 1328 |
| 495 | Ga0206350_11157382 | 3300020080 | Bacteria | 2636 |
| 496 | Ga0213874_10071993 | 3300021377 | Unclassified | 1104 |
| 497 | Ga0224712_10097972 | 3300022467 | Bacteria | 1239 |
| 498 | Ga0224712_10237503 | 3300022467 | Unclassified | 838 |
| 499 | Ga0224570_101218 | 3300022730 | Unclassified | 1994 |
| 500 | Ga0224569_103894 | 3300022732 | Bacteria | 1155 |
| 501 | Ga0224572_1019941 | 3300024225 | Unclassified | 1288 |
| 502 | Ga0228598_1001017 | 3300024227 | Bacteria | 6146 |
| 503 | Ga0207697_10003863 | 3300025315 | Bacteria | 7308 |
| 504 | Ga0207656_10008807 | 3300025321 | Bacteria | 3731 |
| 505 | Ga0207656_10019855 | 3300025321 | Bacteria | 2662 |
| 506 | Ga0207692_10018782 | 3300025898 | Unclassified | 3110 |
| 507 | Ga0207692_10034448 | 3300025898 | Bacteria | 2452 |
| 508 | Ga0207692_10067239 | 3300025898 | Bacteria | 1875 |
| 509 | Ga0207692_10076629 | 3300025898 | Bacteria | 1777 |
| 510 | Ga0207692_10102483 | 3300025898 | Bacteria | 1574 |
| 511 | Ga0207692_10303501 | 3300025898 | Bacteria | 972 |
| 512 | Ga0207642_10004367 | 3300025899 | Bacteria | 4559 |
| 513 | Ga0207642_10014085 | 3300025899 | Unclassified | 2940 |
| 514 | Ga0207642_10110717 | 3300025899 | Bacteria | 1397 |
| 515 | Ga0207642_10269048 | 3300025899 | Bacteria | 975 |
| 516 | Ga0207710_10034258 | 3300025900 | Bacteria | 2231 |
| 517 | Ga0207710_10038745 | 3300025900 | Bacteria | 2108 |
| 518 | Ga0207688_10014841 | 3300025901 | Bacteria | 4227 |
| 519 | Ga0207680_10101778 | 3300025903 | Bacteria | 1847 |
| 520 | Ga0207680_10113856 | 3300025903 | Bacteria | 1759 |
| 521 | Ga0207647_10006770 | 3300025904 | Bacteria | 8319 |
| 522 | Ga0207647_10017691 | 3300025904 | Unclassified | 4841 |
| 523 | Ga0207647_10031767 | 3300025904 | Unclassified | 3396 |
| 524 | Ga0207685_10018401 | 3300025905 | Bacteria | 2280 |
| 525 | Ga0207685_10177591 | 3300025905 | Bacteria | 985 |
| 526 | Ga0207699_10000423 | 3300025906 | Bacteria | 21636 |
| 527 | Ga0207699_10005111 | 3300025906 | Bacteria | 6279 |
| 528 | Ga0207699_10015704 | 3300025906 | Bacteria | 3940 |
| 529 | Ga0207699_10027939 | 3300025906 | Unclassified | 3130 |
| 530 | Ga0207699_10182271 | 3300025906 | Bacteria | 1412 |
| 531 | Ga0207699_10240810 | 3300025906 | Unclassified | 1243 |
| 532 | Ga0207699_10491468 | 3300025906 | Unclassified | 885 |
| 533 | Ga0207645_10000376 | 3300025907 | Bacteria | 36934 |
| 534 | Ga0207645_10037470 | 3300025907 | Bacteria | 3111 |
| 535 | Ga0207643_10000194 | 3300025908 | Bacteria | 41979 |
| 536 | Ga0207643_10157106 | 3300025908 | Unclassified | 1366 |
| 537 | Ga0207705_10046569 | 3300025909 | Bacteria | 3117 |
| 538 | Ga0207684_10002803 | 3300025910 | Bacteria | 17331 |
| 539 | Ga0207684_10003642 | 3300025910 | Bacteria | 14972 |
| 540 | Ga0207684_10066315 | 3300025910 | Bacteria | 3066 |
| 541 | Ga0207684_10128330 | 3300025910 | Unclassified | 2177 |
| 542 | Ga0207684_10213260 | 3300025910 | Unclassified | 1666 |
| 543 | Ga0207654_10036475 | 3300025911 | Unclassified | 2747 |
| 544 | Ga0207654_10046310 | 3300025911 | Bacteria | 2480 |
| 545 | Ga0207654_10049753 | 3300025911 | Bacteria | 2406 |
| 546 | Ga0207654_10069633 | 3300025911 | Unclassified | 2085 |
| 547 | Ga0207654_10198775 | 3300025911 | Bacteria | 1319 |
| 548 | Ga0207654_10317364 | 3300025911 | Bacteria | 1064 |
| 549 | Ga0207654_10420364 | 3300025911 | Unclassified | 933 |
| 550 | Ga0207654_10535023 | 3300025911 | Unclassified | 831 |
| 551 | Ga0207707_10000800 | 3300025912 | Bacteria | 30836 |
| 552 | Ga0207707_10003464 | 3300025912 | Bacteria | 13980 |
| 553 | Ga0207707_10008961 | 3300025912 | Bacteria | 8693 |
| 554 | Ga0207707_10018040 | 3300025912 | Bacteria | 6148 |
| 555 | Ga0207707_10034361 | 3300025912 | Bacteria | 4436 |
| 556 | Ga0207707_10064483 | 3300025912 | Unclassified | 3189 |
| 557 | Ga0207707_10499169 | 3300025912 | Bacteria | 1038 |
| 558 | Ga0207695_10018259 | 3300025913 | Bacteria | 8116 |
| 559 | Ga0207695_10028234 | 3300025913 | Bacteria | 6227 |
| 560 | Ga0207695_10049830 | 3300025913 | Bacteria | 4410 |
| 561 | Ga0207695_10071973 | 3300025913 | Bacteria | 3530 |
| 562 | Ga0207695_10206897 | 3300025913 | Bacteria | 1875 |
| 563 | Ga0207695_10475059 | 3300025913 | Bacteria | 1132 |
| 564 | Ga0207671_10020926 | 3300025914 | Bacteria | 4973 |
| 565 | Ga0207671_10158462 | 3300025914 | Bacteria | 1752 |
| 566 | Ga0207671_10246618 | 3300025914 | Unclassified | 1404 |
| 567 | Ga0207671_10522239 | 3300025914 | Unclassified | 947 |
| 568 | Ga0207671_10641769 | 3300025914 | Unclassified | 846 |
| 569 | Ga0207671_10851151 | 3300025914 | Unclassified | 722 |
| 570 | Ga0207693_10000024 | 3300025915 | Bacteria | 125885 |
| 571 | Ga0207693_10000214 | 3300025915 | Bacteria | 53256 |
| 572 | Ga0207693_10001731 | 3300025915 | Bacteria | 19165 |
| 573 | Ga0207693_10008124 | 3300025915 | Bacteria | 8602 |
| 574 | Ga0207693_10015084 | 3300025915 | Bacteria | 6202 |
| 575 | Ga0207693_10045616 | 3300025915 | Bacteria | 3444 |
| 576 | Ga0207693_10195472 | 3300025915 | Bacteria | 1591 |
| 577 | Ga0207693_10238573 | 3300025915 | Unclassified | 1427 |
| 578 | Ga0207693_10513648 | 3300025915 | Unclassified | 935 |
| 579 | Ga0207663_10007091 | 3300025916 | Bacteria | 5787 |
| 580 | Ga0207663_10008315 | 3300025916 | Bacteria | 5418 |
| 581 | Ga0207663_10009352 | 3300025916 | Bacteria | 5173 |
| 582 | Ga0207663_10024149 | 3300025916 | Bacteria | 3498 |
| 583 | Ga0207663_10077451 | 3300025916 | Bacteria | 2164 |
| 584 | Ga0207663_10185342 | 3300025916 | Unclassified | 1490 |
| 585 | Ga0207663_10350788 | 3300025916 | Bacteria | 1117 |
| 586 | Ga0207663_10365848 | 3300025916 | Bacteria | 1095 |
| 587 | Ga0207663_10617102 | 3300025916 | Unclassified | 853 |
| 588 | Ga0207660_10019266 | 3300025917 | Bacteria | 4559 |
| 589 | Ga0207660_10281806 | 3300025917 | Bacteria | 1319 |
| 590 | Ga0207660_10336398 | 3300025917 | Bacteria | 1208 |
| 591 | Ga0207660_10386048 | 3300025917 | Bacteria | 1126 |
| 592 | Ga0207660_10432805 | 3300025917 | Unclassified | 1062 |
| 593 | Ga0207662_10001408 | 3300025918 | Bacteria | 11646 |
| 594 | Ga0207657_10002947 | 3300025919 | Bacteria | 18257 |
| 595 | Ga0207657_10004279 | 3300025919 | Bacteria | 15127 |
| 596 | Ga0207657_10010820 | 3300025919 | Bacteria | 9078 |
| 597 | Ga0207649_10001260 | 3300025920 | Bacteria | 15148 |
| 598 | Ga0207649_10037225 | 3300025920 | Bacteria | 2937 |
| 599 | Ga0207649_10043965 | 3300025920 | Bacteria | 2734 |
| 600 | Ga0207649_10551739 | 3300025920 | Bacteria | 882 |
| 601 | Ga0207652_10052324 | 3300025921 | Bacteria | 3504 |
| 602 | Ga0207652_10253362 | 3300025921 | Unclassified | 1587 |
| 603 | Ga0207652_10292653 | 3300025921 | Unclassified | 1469 |
| 604 | Ga0207652_10346332 | 3300025921 | Bacteria | 1341 |
| 605 | Ga0207652_10887227 | 3300025921 | Bacteria | 788 |
| 606 | Ga0207646_10001233 | 3300025922 | Bacteria | 32128 |
| 607 | Ga0207646_10006853 | 3300025922 | Bacteria | 11711 |
| 608 | Ga0207646_10120223 | 3300025922 | Bacteria | 2360 |
| 609 | Ga0207646_10283858 | 3300025922 | Bacteria | 1496 |
| 610 | Ga0207646_10424835 | 3300025922 | Bacteria | 1200 |
| 611 | Ga0207646_10479440 | 3300025922 | Unclassified | 1122 |
| 612 | Ga0207646_10749878 | 3300025922 | Bacteria | 871 |
| 613 | Ga0207646_11186073 | 3300025922 | Bacteria | 670 |
| 614 | Ga0207646_11394985 | 3300025922 | Unclassified | 609 |
| 615 | Ga0207694_10000434 | 3300025924 | Bacteria | 38832 |
| 616 | Ga0207694_10031776 | 3300025924 | Bacteria | 4035 |
| 617 | Ga0207694_10065067 | 3300025924 | Bacteria | 2842 |
| 618 | Ga0207650_10000216 | 3300025925 | Bacteria | 65683 |
| 619 | Ga0207650_10045927 | 3300025925 | Unclassified | 3215 |
| 620 | Ga0207650_10275198 | 3300025925 | Bacteria | 1369 |
| 621 | Ga0207659_10178763 | 3300025926 | Bacteria | 1679 |
| 622 | Ga0207687_10315703 | 3300025927 | Unclassified | 1263 |
| 623 | Ga0207700_10003049 | 3300025928 | Bacteria | 9665 |
| 624 | Ga0207700_10008553 | 3300025928 | Bacteria | 6350 |
| 625 | Ga0207700_10009126 | 3300025928 | Bacteria | 6176 |
| 626 | Ga0207700_10022345 | 3300025928 | Bacteria | 4340 |
| 627 | Ga0207700_10025588 | 3300025928 | Bacteria | 4101 |
| 628 | Ga0207700_10083494 | 3300025928 | Bacteria | 2501 |
| 629 | Ga0207700_10115398 | 3300025928 | Bacteria | 2168 |
| 630 | Ga0207700_10117120 | 3300025928 | Unclassified | 2154 |
| 631 | Ga0207700_10122746 | 3300025928 | Bacteria | 2109 |
| 632 | Ga0207700_10163626 | 3300025928 | Bacteria | 1850 |
| 633 | Ga0207700_10187467 | 3300025928 | Unclassified | 1736 |
| 634 | Ga0207700_10195915 | 3300025928 | Unclassified | 1700 |
| 635 | Ga0207700_10276955 | 3300025928 | Bacteria | 1442 |
| 636 | Ga0207700_10356448 | 3300025928 | Bacteria | 1275 |
| 637 | Ga0207700_10478464 | 3300025928 | Unclassified | 1100 |
| 638 | Ga0207700_10742627 | 3300025928 | Unclassified | 877 |
| 639 | Ga0207664_10000607 | 3300025929 | Bacteria | 24798 |
| 640 | Ga0207664_10003402 | 3300025929 | Bacteria | 10595 |
| 641 | Ga0207664_10013520 | 3300025929 | Bacteria | 5862 |
| 642 | Ga0207664_10065055 | 3300025929 | Bacteria | 2918 |
| 643 | Ga0207664_10235165 | 3300025929 | Unclassified | 1594 |
| 644 | Ga0207664_10242000 | 3300025929 | Bacteria | 1572 |
| 645 | Ga0207664_10293729 | 3300025929 | Bacteria | 1429 |
| 646 | Ga0207664_10566030 | 3300025929 | Bacteria | 1020 |
| 647 | Ga0207664_11210940 | 3300025929 | Bacteria | 673 |
| 648 | Ga0207644_10040273 | 3300025931 | Bacteria | 3302 |
| 649 | Ga0207644_10086751 | 3300025931 | Bacteria | 2324 |
| 650 | Ga0207644_10637881 | 3300025931 | Unclassified | 886 |
| 651 | Ga0207690_10033647 | 3300025932 | Bacteria | 3297 |
| 652 | Ga0207690_10053600 | 3300025932 | Bacteria | 2707 |
| 653 | Ga0207690_10078606 | 3300025932 | Bacteria | 2296 |
| 654 | Ga0207690_10253114 | 3300025932 | Bacteria | 1361 |
| 655 | Ga0207706_10000868 | 3300025933 | Bacteria | 31136 |
| 656 | Ga0207706_10014363 | 3300025933 | Bacteria | 7176 |
| 657 | Ga0207706_10032789 | 3300025933 | Bacteria | 4623 |
| 658 | Ga0207706_10097987 | 3300025933 | Unclassified | 2579 |
| 659 | Ga0207686_10432009 | 3300025934 | Unclassified | 1009 |
| 660 | Ga0207709_10187376 | 3300025935 | Bacteria | 1466 |
| 661 | Ga0207670_10001554 | 3300025936 | Bacteria | 12083 |
| 662 | Ga0207669_10036908 | 3300025937 | Bacteria | 2798 |
| 663 | Ga0207704_10006939 | 3300025938 | Bacteria | 5314 |
| 664 | Ga0207704_10021498 | 3300025938 | Bacteria | 3438 |
| 665 | Ga0207704_10085128 | 3300025938 | Unclassified | 2057 |
| 666 | Ga0207704_10631510 | 3300025938 | Unclassified | 880 |
| 667 | Ga0207665_10000329 | 3300025939 | Bacteria | 32870 |
| 668 | Ga0207665_10030987 | 3300025939 | Bacteria | 3538 |
| 669 | Ga0207665_10037027 | 3300025939 | Bacteria | 3246 |
| 670 | Ga0207665_10041249 | 3300025939 | Bacteria | 3081 |
| 671 | Ga0207665_10106501 | 3300025939 | Bacteria | 1965 |
| 672 | Ga0207665_10140359 | 3300025939 | Unclassified | 1722 |
| 673 | Ga0207665_10212331 | 3300025939 | Unclassified | 1414 |
| 674 | Ga0207665_10214247 | 3300025939 | Bacteria | 1409 |
| 675 | Ga0207665_10235104 | 3300025939 | Bacteria | 1348 |
| 676 | Ga0207665_10472234 | 3300025939 | Unclassified | 965 |
| 677 | Ga0207691_10000459 | 3300025940 | Bacteria | 40352 |
| 678 | Ga0207691_10545967 | 3300025940 | Unclassified | 983 |
| 679 | Ga0207711_10002757 | 3300025941 | Bacteria | 15476 |
| 680 | Ga0207711_10004283 | 3300025941 | Bacteria | 12191 |
| 681 | Ga0207711_10004875 | 3300025941 | Bacteria | 11390 |
| 682 | Ga0207711_10386704 | 3300025941 | Bacteria | 1299 |
| 683 | Ga0207711_10403708 | 3300025941 | Bacteria | 1270 |
| 684 | Ga0207711_10730866 | 3300025941 | Bacteria | 923 |
| 685 | Ga0207689_10000166 | 3300025942 | Bacteria | 57369 |
| 686 | Ga0207689_10001458 | 3300025942 | Bacteria | 22635 |
| 687 | Ga0207689_10031999 | 3300025942 | Bacteria | 4375 |
| 688 | Ga0207689_10046784 | 3300025942 | Unclassified | 3574 |
| 689 | Ga0207689_10135088 | 3300025942 | Bacteria | 2031 |
| 690 | Ga0207661_10001667 | 3300025944 | Bacteria | 15142 |
| 691 | Ga0207661_10087290 | 3300025944 | Unclassified | 2590 |
| 692 | Ga0207661_10119206 | 3300025944 | Bacteria | 2244 |
| 693 | Ga0207679_10000496 | 3300025945 | Bacteria | 27124 |
| 694 | Ga0207679_10004667 | 3300025945 | Bacteria | 8536 |
| 695 | Ga0207679_10013182 | 3300025945 | Bacteria | 5415 |
| 696 | Ga0207679_10062735 | 3300025945 | Unclassified | 2771 |
| 697 | Ga0207679_10238884 | 3300025945 | Bacteria | 1538 |
| 698 | Ga0207667_10000213 | 3300025949 | Bacteria | 81973 |
| 699 | Ga0207667_10003075 | 3300025949 | Bacteria | 20688 |
| 700 | Ga0207667_10265135 | 3300025949 | Unclassified | 1757 |
| 701 | Ga0207667_10339491 | 3300025949 | Bacteria | 1533 |
| 702 | Ga0207667_10394207 | 3300025949 | Bacteria | 1410 |
| 703 | Ga0207651_10064958 | 3300025960 | Bacteria | 2556 |
| 704 | Ga0207651_10168669 | 3300025960 | Bacteria | 1724 |
| 705 | Ga0207712_10021189 | 3300025961 | Bacteria | 4265 |
| 706 | Ga0207712_10032280 | 3300025961 | Bacteria | 3534 |
| 707 | Ga0207668_10018828 | 3300025972 | Bacteria | 4353 |
| 708 | Ga0207668_10169345 | 3300025972 | Bacteria | 1711 |
| 709 | Ga0207640_10016573 | 3300025981 | Unclassified | 4290 |
| 710 | Ga0207640_10032474 | 3300025981 | Bacteria | 3237 |
| 711 | Ga0207640_10112138 | 3300025981 | Bacteria | 1936 |
| 712 | Ga0207640_10189376 | 3300025981 | Bacteria | 1549 |
| 713 | Ga0207640_10726855 | 3300025981 | Unclassified | 854 |
| 714 | Ga0207658_10147651 | 3300025986 | Bacteria | 1911 |
| 715 | Ga0207658_10187202 | 3300025986 | Bacteria | 1718 |
| 716 | Ga0207658_10673197 | 3300025986 | Unclassified | 934 |
| 717 | Ga0207658_10714698 | 3300025986 | Unclassified | 906 |
| 718 | Ga0207677_10018312 | 3300026023 | Bacteria | 4200 |
| 719 | Ga0207677_10029386 | 3300026023 | Bacteria | 3492 |
| 720 | Ga0207677_10089122 | 3300026023 | Unclassified | 2239 |
| 721 | Ga0207677_10315951 | 3300026023 | Bacteria | 1296 |
| 722 | Ga0207677_10875546 | 3300026023 | Unclassified | 808 |
| 723 | Ga0207703_10005501 | 3300026035 | Bacteria | 10182 |
| 724 | Ga0207703_10048898 | 3300026035 | Bacteria | 3416 |
| 725 | Ga0207703_10225667 | 3300026035 | Bacteria | 1677 |
| 726 | Ga0207703_10572438 | 3300026035 | Unclassified | 1066 |
| 727 | Ga0207703_10628668 | 3300026035 | Unclassified | 1017 |
| 728 | Ga0207639_10034997 | 3300026041 | Bacteria | 3716 |
| 729 | Ga0207639_10052098 | 3300026041 | Bacteria | 3117 |
| 730 | Ga0207639_10206472 | 3300026041 | Bacteria | 1688 |
| 731 | Ga0207639_10766067 | 3300026041 | Bacteria | 898 |
| 732 | Ga0207639_10796705 | 3300026041 | Unclassified | 880 |
| 733 | Ga0207678_10000328 | 3300026067 | Bacteria | 42509 |
| 734 | Ga0207678_10002447 | 3300026067 | Bacteria | 16873 |
| 735 | Ga0207678_10124199 | 3300026067 | Bacteria | 2202 |
| 736 | Ga0207702_10000114 | 3300026078 | Bacteria | 93951 |
| 737 | Ga0207702_10001495 | 3300026078 | Bacteria | 23103 |
| 738 | Ga0207702_10007437 | 3300026078 | Bacteria | 9347 |
| 739 | Ga0207702_10020286 | 3300026078 | Bacteria | 5506 |
| 740 | Ga0207702_10432549 | 3300026078 | Unclassified | 1274 |
| 741 | Ga0207702_10602011 | 3300026078 | Unclassified | 1078 |
| 742 | Ga0207641_10001283 | 3300026088 | Bacteria | 25008 |
| 743 | Ga0207641_10040915 | 3300026088 | Bacteria | 3883 |
| 744 | Ga0207641_10044284 | 3300026088 | Unclassified | 3742 |
| 745 | Ga0207641_10176197 | 3300026088 | Unclassified | 1955 |
| 746 | Ga0207641_10296256 | 3300026088 | Unclassified | 1526 |
| 747 | Ga0207641_10923134 | 3300026088 | Bacteria | 867 |
| 748 | Ga0207648_10000826 | 3300026089 | Bacteria | 34905 |
| 749 | Ga0207648_10059874 | 3300026089 | Bacteria | 3321 |
| 750 | Ga0207648_10066105 | 3300026089 | Bacteria | 3153 |
| 751 | Ga0207648_10755061 | 3300026089 | Bacteria | 904 |
| 752 | Ga0207648_11166450 | 3300026089 | Unclassified | 723 |
| 753 | Ga0207676_10000058 | 3300026095 | Bacteria | 120315 |
| 754 | Ga0207676_10002123 | 3300026095 | Bacteria | 14348 |
| 755 | Ga0207676_10036414 | 3300026095 | Unclassified | 3743 |
| 756 | Ga0207674_10000148 | 3300026116 | Bacteria | 82478 |
| 757 | Ga0207674_10000860 | 3300026116 | Bacteria | 39670 |
| 758 | Ga0207674_10001389 | 3300026116 | Bacteria | 31181 |
| 759 | Ga0207674_10049534 | 3300026116 | Bacteria | 4295 |
| 760 | Ga0207674_10058791 | 3300026116 | Bacteria | 3893 |
| 761 | Ga0207674_10186877 | 3300026116 | Bacteria | 2022 |
| 762 | Ga0207675_100275256 | 3300026118 | Bacteria | 1634 |
| 763 | Ga0207683_10013575 | 3300026121 | Bacteria | 6949 |
| 764 | Ga0207683_10153126 | 3300026121 | Bacteria | 2082 |
| 765 | Ga0207683_10231082 | 3300026121 | Unclassified | 1687 |
| 766 | Ga0207698_10007054 | 3300026142 | Bacteria | 7036 |
| 767 | Ga0207698_10131924 | 3300026142 | Bacteria | 2136 |
| 768 | Ga0207698_10145340 | 3300026142 | Unclassified | 2050 |
| 769 | Ga0207698_10245530 | 3300026142 | Bacteria | 1635 |
| 770 | Ga0207698_10878364 | 3300026142 | Unclassified | 903 |
| 771 | Ga0209588_1140410 | 3300027671 | Bacteria | 768 |
| 772 | Ga0265356_1000040 | 3300028017 | Bacteria | 20826 |
| 773 | Ga0268266_10074822 | 3300028379 | Bacteria | 2941 |
| 774 | Ga0268266_10396620 | 3300028379 | Unclassified | 1304 |
| 775 | Ga0268265_10026162 | 3300028380 | Bacteria | 4148 |
| 776 | Ga0268265_10212363 | 3300028380 | Bacteria | 1687 |
| 777 | Ga0268264_10054667 | 3300028381 | Unclassified | 3334 |
| 778 | Ga0268264_10093906 | 3300028381 | Bacteria | 2593 |
| 779 | Ga0268264_10175561 | 3300028381 | Bacteria | 1941 |
| 780 | Ga0268264_10278252 | 3300028381 | Bacteria | 1566 |
| 781 | Ga0265338_10008016 | 3300028800 | Bacteria | 12927 |
| 782 | Ga0265338_10010465 | 3300028800 | Bacteria | 10868 |
| 783 | Ga0265338_10099047 | 3300028800 | Bacteria | 2382 |
| 784 | Ga0265762_1002743 | 3300030760 | Bacteria | 3151 |
| 785 | Ga0265762_1012728 | 3300030760 | Bacteria | 1511 |
| 786 | Ga0265767_104246 | 3300030836 | Bacteria | 833 |
| 787 | Ga0265770_1002756 | 3300030878 | Bacteria | 2385 |
| 788 | Ga0265760_10000172 | 3300031090 | Bacteria | 17165 |
| 789 | Ga0265760_10006480 | 3300031090 | Bacteria | 3347 |
| 790 | Ga0265760_10008939 | 3300031090 | Bacteria | 2861 |
| 791 | Ga0265760_10012223 | 3300031090 | Unclassified | 2453 |
| 792 | Ga0265760_10071720 | 3300031090 | Bacteria | 1063 |
| 793 | Ga0265325_10021987 | 3300031241 | Bacteria | 3498 |
| 794 | Ga0265325_10072187 | 3300031241 | Bacteria | 1731 |
| 795 | Ga0265339_10124375 | 3300031249 | Unclassified | 1323 |
| 796 | Ga0265316_10197606 | 3300031344 | Bacteria | 1492 |
| 797 | Ga0265314_10002967 | 3300031711 | Bacteria | 16812 |
| 798 | Ga0265314_10022093 | 3300031711 | Bacteria | 4878 |
| 799 | Ga0316214_1002952 | 3300033545 | Unclassified | 2119 |
| 800 | Ga0316214_1025086 | 3300033545 | Unclassified | 839 |
| 801 | Ga0316212_1022695 | 3300033547 | Unclassified | 879 |
| 802 | Ga0373948_0024983 | 3300034817 | Bacteria | 1169 |
| 803 | Ga0373934_0035489 | 3300035086 | Unclassified | 1962 |
| 804 | Ga0373940_0170900 | 3300035088 | Unclassified | 702 |
| 805 | Ga0373944_0075397 | 3300035089 | Unclassified | 1106 |
| 806 | Ga0373923_0044959 | 3300035111 | Unclassified | 1833 |
| 807 | Ga0373932_0039896 | 3300035112 | Bacteria | 1349 |
| 808 | Ga0373936_0004143 | 3300035113 | Bacteria | 5466 |
| 809 | Ga0373936_0068571 | 3300035113 | Unclassified | 1458 |
| 810 | Ga0373936_0084815 | 3300035113 | Unclassified | 1322 |
| 811 | Ga0373941_0165355 | 3300035115 | Unclassified | 821 |
| 812 | Ga0373945_0011201 | 3300035116 | Bacteria | 2962 |
| 813 | Ga0373945_0033738 | 3300035116 | Bacteria | 1821 |
| 814 | Ga0373945_0149661 | 3300035116 | Unclassified | 945 |
| 815 | Ga0373953_0018713 | 3300035117 | Bacteria | 2567 |
| 816 | Ga0373954_0038167 | 3300035118 | Unclassified | 2233 |
| 817 | Ga0373957_0063596 | 3300035120 | Unclassified | 1433 |
| 818 | Ga0373943_0003361 | 3300035170 | Bacteria | 7269 |
| 819 | Ga0373943_0119556 | 3300035170 | Unclassified | 1399 |
| 820 | Ga0373943_0336782 | 3300035170 | Bacteria | 862 |
| 821 | Ga0373943_0491519 | 3300035170 | Unclassified | 716 |
| 822 | Ga0373946_0027897 | 3300035171 | Bacteria | 2236 |
| 823 | Ga0373946_0115928 | 3300035171 | Unclassified | 1218 |
| 824 | Ga0373955_0044316 | 3300035172 | Bacteria | 2395 |
| 825 | Ga0373955_0179627 | 3300035172 | Unclassified | 1255 |
| 826 | Ga0373942_0083517 | 3300035207 | Unclassified | 952 |
| 827 | Ga0373924_0008187 | 3300035410 | Unclassified | 3791 |
| 828 | Ga0373931_0224926 | 3300035691 | Unclassified | 1131 |
| 829 | Ga0373935_0010998 | 3300035692 | Bacteria | 5436 |
| 830 | Ga0373935_0024085 | 3300035692 | Bacteria | 3744 |
| 831 | Ga0373935_0042141 | 3300035692 | Bacteria | 2870 |
| 832 | Ga0373935_0088933 | 3300035692 | Unclassified | 2019 |
| 833 | Ga0373927_0000097 | 3300035695 | Bacteria | 66228 |
| 834 | Ga0373927_0009726 | 3300035695 | Bacteria | 6445 |
| 835 | Ga0373927_0066421 | 3300035695 | Bacteria | 2333 |
| 836 | Ga0373927_0101974 | 3300035695 | Unclassified | 1867 |
| 837 | Ga0373927_0235915 | 3300035695 | Unclassified | 1202 |
| 838 | Ga0373933_0008807 | 3300035724 | Bacteria | 5501 |
| 839 | Ga0373933_0039974 | 3300035724 | Unclassified | 2761 |
| 840 | Ga0373933_0175895 | 3300035724 | Unclassified | 1364 |
| 841 | Ga0373933_0331108 | 3300035724 | Unclassified | 988 |
| 842 | Ga0373933_0413017 | 3300035724 | Unclassified | 881 |
| 843 | Ga0373933_0517863 | 3300035724 | Unclassified | 782 |
| 844 | Ga0373947_0000273 | 3300035725 | Bacteria | 29358 |
| 845 | Ga0373947_0004931 | 3300035725 | Bacteria | 7805 |
| 846 | Ga0373947_0103524 | 3300035725 | Bacteria | 1792 |
| 847 | Ga0373937_0019513 | 3300036401 | Bacteria | 6066 |
| 848 | Ga0373937_0023853 | 3300036401 | Bacteria | 5516 |
| 849 | Ga0373937_0057487 | 3300036401 | Unclassified | 3573 |
| 850 | Ga0373937_0064885 | 3300036401 | Unclassified | 3360 |
| 851 | Ga0373937_0102846 | 3300036401 | Bacteria | 2652 |
| 852 | Ga0373937_0430781 | 3300036401 | Unclassified | 1252 |
| 853 | Ga0373937_0519497 | 3300036401 | Unclassified | 1131 |
| 854 | Ga0373925_0003931 | 3300037068 | Bacteria | 11347 |
| 855 | Ga0373925_0007055 | 3300037068 | Bacteria | 8209 |
| 856 | Ga0373925_0014525 | 3300037068 | Bacteria | 5691 |
| 857 | Ga0373925_0079427 | 3300037068 | Bacteria | 2493 |
| 858 | Ga0373925_0167640 | 3300037068 | Unclassified | 1732 |
| 859 | Ga0373925_0168463 | 3300037068 | Unclassified | 1728 |
| 860 | Ga0436364_1110329 | 3300037853 | Bacteria | 2446 |
| 861 | Ga0436360_0028730 | 3300039438 | Bacteria | 2384 |
| 862 | Ga0436362_1017484 | 3300039453 | Bacteria | 4646 |
| 863 | Ga0466965_0088475 | 3300044683 | Unclassified | 1573 |
| 864 | Ga0466961_0140333 | 3300044693 | Unclassified | 1513 |
| 865 | Ga0466963_0139862 | 3300044694 | Unclassified | 1676 |
| 866 | Ga0466964_0350797 | 3300044706 | Bacteria | 758 |
| 867 | Ga0453684_0312454 | 3300044712 | Bacteria | 1783 |
| 868 | Ga0466971_0084679 | 3300044719 | Unclassified | 1448 |
| 869 | Ga0466957_0222445 | 3300044842 | Unclassified | 1247 |
| 870 | Ga0466959_0440776 | 3300045049 | Unclassified | 883 |
| 871 | Ga0451576_0613687 | 3300045051 | Bacteria | 1143 |
| 872 | Ga0451576_0987032 | 3300045051 | Bacteria | 883 |
| 873 | Ga0451576_1280470 | 3300045051 | Unclassified | 764 |
| 874 | Ga0466958_0247231 | 3300045836 | Unclassified | 1140 |
| 875 | Ga0466967_0069816 | 3300045976 | Bacteria | 3141 |
| 876 | Ga0466967_0446093 | 3300045976 | Bacteria | 1264 |
| 877 | Ga0495629_0062294 | 3300046459 | Unclassified | 2606 |
| 878 | Ga0495653_0402536 | 3300046463 | Unclassified | 870 |
| 879 | Ga0495580_0000068 | 3300046472 | Bacteria | 63122 |
| 880 | Ga0495580_0000390 | 3300046472 | Bacteria | 35923 |
| 881 | Ga0495580_0000632 | 3300046472 | Bacteria | 29798 |
| 882 | Ga0495580_0003018 | 3300046472 | Bacteria | 14420 |
| 883 | Ga0495580_0038873 | 3300046472 | Unclassified | 3405 |
| 884 | Ga0495580_0047143 | 3300046472 | Bacteria | 3056 |
| 885 | Ga0495580_0048399 | 3300046472 | Unclassified | 3010 |
| 886 | Ga0495580_0182290 | 3300046472 | Bacteria | 1450 |
| 887 | Ga0495580_0182775 | 3300046472 | Bacteria | 1448 |
| 888 | Ga0495580_0283368 | 3300046472 | Unclassified | 1130 |
| 889 | Ga0495580_0292271 | 3300046472 | Bacteria | 1111 |
| 890 | Ga0495582_0000291 | 3300046473 | Bacteria | 27648 |
| 891 | Ga0495582_0116590 | 3300046473 | Unclassified | 1502 |
| 892 | Ga0495662_0178004 | 3300046476 | Unclassified | 1048 |
| 893 | Ga0495664_0042440 | 3300046477 | Unclassified | 2694 |
| 894 | Ga0495628_0170727 | 3300046516 | Bacteria | 1649 |
| 895 | Ga0495628_0251890 | 3300046516 | Unclassified | 1318 |
| 896 | Ga0495630_0032613 | 3300046517 | Unclassified | 3883 |
| 897 | Ga0495630_0112947 | 3300046517 | Bacteria | 2058 |
| 898 | Ga0495630_0572127 | 3300046517 | Unclassified | 866 |
| 899 | Ga0495630_0773224 | 3300046517 | Unclassified | 734 |
| 900 | Ga0495666_0046554 | 3300046526 | Bacteria | 2091 |
| 901 | Ga0495652_0183427 | 3300046529 | Bacteria | 1604 |
| 902 | Ga0495665_0026314 | 3300046531 | Unclassified | 3124 |
| 903 | Ga0495665_0129909 | 3300046531 | Bacteria | 1319 |
| 904 | Ga0495665_0266268 | 3300046531 | Unclassified | 881 |
| 905 | Ga0495586_0202657 | 3300046535 | Unclassified | 1125 |
| 906 | Ga0495587_0085692 | 3300046536 | Unclassified | 1824 |
| 907 | Ga0495645_0063479 | 3300046543 | Bacteria | 2674 |
| 908 | Ga0495634_0448689 | 3300046642 | Unclassified | 761 |
| 909 | Ga0495659_0134217 | 3300046664 | Bacteria | 983 |
| 910 | Ga0495599_0206136 | 3300046678 | Bacteria | 1207 |
| 911 | Ga0495658_0008453 | 3300046683 | Bacteria | 5101 |
| 912 | Ga0495658_0527980 | 3300046683 | Bacteria | 755 |
| 913 | Ga0495613_0262864 | 3300046689 | Unclassified | 1202 |
| 914 | Ga0495670_0112837 | 3300046691 | Unclassified | 1408 |
| 915 | Ga0495581_0435666 | 3300047315 | Unclassified | 764 |
| 916 | Ga0495604_0329445 | 3300047317 | Unclassified | 1019 |
| 917 | Ga0495674_0016019 | 3300047319 | Bacteria | 6996 |
| 918 | Ga0495674_0103640 | 3300047319 | Bacteria | 2419 |
| 919 | Ga0495674_0139553 | 3300047319 | Unclassified | 2038 |
| 920 | Ga0495674_0337862 | 3300047319 | Unclassified | 1224 |
| 921 | Ga0495674_0648838 | 3300047319 | Unclassified | 832 |
| 922 | Ga0495676_0198784 | 3300047321 | Unclassified | 1394 |
| 923 | Ga0495676_0426488 | 3300047321 | Unclassified | 877 |
| 924 | Ga0495675_0058923 | 3300047444 | Bacteria | 2435 |
| 925 | Ga0495684_0501770 | 3300047471 | Bacteria | 834 |
| 926 | Ga0495602_0095210 | 3300048088 | Bacteria | 2459 |
| 927 | Ga0495602_0305789 | 3300048088 | Unclassified | 1162 |
| 928 | Ga0496100_0119274 | 3300048903 | Bacteria | 1843 |
| 929 | Ga0496100_0233714 | 3300048903 | Bacteria | 1354 |
| 930 | Ga0496100_0344815 | 3300048903 | Bacteria | 1124 |
| 931 | Ga0496100_0488136 | 3300048903 | Bacteria | 948 |
| 932 | Ga0496100_0937622 | 3300048903 | Unclassified | 680 |
| 933 | Ga0496101_0038805 | 3300048904 | Bacteria | 3384 |
| 934 | Ga0496101_0117394 | 3300048904 | Bacteria | 2009 |
| 935 | Ga0496101_0309521 | 3300048904 | Bacteria | 1238 |
| 936 | Ga0496101_0450630 | 3300048904 | Bacteria | 1015 |
| 937 | Ga0496102_0010132 | 3300048905 | Bacteria | 8106 |
| 938 | Ga0496102_0046899 | 3300048905 | Bacteria | 3925 |
| 939 | Ga0496102_0053318 | 3300048905 | Bacteria | 3687 |
| 940 | Ga0496102_0194099 | 3300048905 | Bacteria | 1914 |
| 941 | Ga0496102_0340715 | 3300048905 | Unclassified | 1412 |
| 942 | Ga0496102_0396889 | 3300048905 | Bacteria | 1297 |
| 943 | Ga0496102_0412569 | 3300048905 | Unclassified | 1269 |
| 944 | Ga0496103_0003667 | 3300048906 | Bacteria | 9348 |
| 945 | Ga0496103_0114317 | 3300048906 | Unclassified | 1716 |
| 946 | Ga0496104_0064252 | 3300048907 | Unclassified | 3482 |
| 947 | Ga0496104_0065831 | 3300048907 | Bacteria | 3440 |
| 948 | Ga0496104_0093388 | 3300048907 | Bacteria | 2878 |
| 949 | Ga0496104_0148251 | 3300048907 | Bacteria | 2253 |
| 950 | Ga0496104_0230735 | 3300048907 | Bacteria | 1763 |
| 951 | Ga0496104_0572586 | 3300048907 | Unclassified | 1040 |
| 952 | Ga0496105_0219216 | 3300048908 | Unclassified | 1549 |
| 953 | Ga0496105_0265041 | 3300048908 | Unclassified | 1389 |
| 954 | Ga0496105_0275814 | 3300048908 | Bacteria | 1357 |
| 955 | Ga0496106_0031873 | 3300048909 | Bacteria | 3928 |
| 956 | Ga0496106_0089262 | 3300048909 | Bacteria | 2377 |
| 957 | Ga0496106_0104752 | 3300048909 | Bacteria | 2197 |
| 958 | Ga0496106_0359074 | 3300048909 | Bacteria | 1170 |
| 959 | Ga0496106_0372534 | 3300048909 | Unclassified | 1147 |
| 960 | Ga0496107_0025905 | 3300048910 | Bacteria | 4156 |
| 961 | Ga0496107_0108449 | 3300048910 | Bacteria | 2039 |
| 962 | Ga0496108_0000170 | 3300048911 | Bacteria | 61234 |
| 963 | Ga0496108_0039842 | 3300048911 | Bacteria | 3916 |
| 964 | Ga0496108_0284098 | 3300048911 | Bacteria | 1440 |
| 965 | Ga0496108_0346063 | 3300048911 | Bacteria | 1297 |
| 966 | Ga0496108_0412356 | 3300048911 | Unclassified | 1180 |
| 967 | Ga0496109_0000621 | 3300048912 | Bacteria | 29592 |
| 968 | Ga0496109_0055729 | 3300048912 | Bacteria | 3606 |
| 969 | Ga0496109_0522454 | 3300048912 | Unclassified | 1120 |
| 970 | Ga0496110_0019980 | 3300048913 | Bacteria | 5646 |
| 971 | Ga0496110_0392830 | 3300048913 | Bacteria | 1264 |
| 972 | Ga0496110_0734514 | 3300048913 | Bacteria | 890 |
| 973 | Ga0496111_0002648 | 3300048914 | Bacteria | 10857 |
| 974 | Ga0496111_0371204 | 3300048914 | Bacteria | 1058 |
| 975 | Ga0496112_0000152 | 3300048915 | Bacteria | 43283 |
| 976 | Ga0496112_0001076 | 3300048915 | Bacteria | 20196 |
| 977 | Ga0496112_0010933 | 3300048915 | Bacteria | 8264 |
| 978 | Ga0496112_0011133 | 3300048915 | Bacteria | 8201 |
| 979 | Ga0496112_0218716 | 3300048915 | Unclassified | 1861 |
| 980 | Ga0496112_0534070 | 3300048915 | Unclassified | 1107 |
| 981 | Ga0496112_0749567 | 3300048915 | Bacteria | 903 |
| 982 | Ga0496112_0885368 | 3300048915 | Unclassified | 815 |
| 983 | Ga0496113_0018313 | 3300048916 | Unclassified | 4875 |
| 984 | Ga0496113_0053888 | 3300048916 | Unclassified | 3008 |
| 985 | Ga0496113_0133330 | 3300048916 | Bacteria | 1951 |
| 986 | Ga0496113_0418134 | 3300048916 | Bacteria | 1077 |
| 987 | Ga0496114_0024403 | 3300048917 | Bacteria | 4936 |
| 988 | Ga0496114_0056277 | 3300048917 | Bacteria | 3282 |
| 989 | Ga0496115_0012647 | 3300048918 | Bacteria | 6360 |
| 990 | Ga0496115_0043711 | 3300048918 | Bacteria | 3573 |
| 991 | Ga0496115_0224682 | 3300048918 | Unclassified | 1549 |
| 992 | Ga0496115_0344194 | 3300048918 | Unclassified | 1216 |
| 993 | Ga0495682_0174605 | 3300049460 | Unclassified | 764 |
| 994 | Ga0501073_0514696 | 3300049589 | Unclassified | 827 |
| 995 | Ga0501083_0285583 | 3300049744 | Unclassified | 1073 |
| 996 | nmdc:mga0n895_1163_c1 | 3300050512 | Bacteria | 19263 |
| 997 | nmdc:mga0n895_1999_c1 | 3300050512 | Bacteria | 15655 |
| 998 | nmdc:mga0n895_404245_c1 | 3300050512 | Bacteria | 1381 |
| 999 | nmdc:mga0n895_819076_c1 | 3300050512 | Unclassified | 920 |
| 1000 | nmdc:mga0rr50_457197_c1 | 3300050513 | Unclassified | 1083 |
| 1001 | nmdc:mga08x19_103183_c1 | 3300050514 | Bacteria | 1894 |
| 1002 | nmdc:mga08x19_3802_c1 | 3300050514 | Bacteria | 7105 |
| 1003 | nmdc:mga08x19_859_c1 | 3300050514 | Bacteria | 19283 |
| 1004 | nmdc:mga0a205_164152_c1 | 3300050515 | Unclassified | 2117 |
| 1005 | nmdc:mga0a205_25343_c1 | 3300050515 | Bacteria | 5650 |
| 1006 | Ga0495601_0057857 | 3300053077 | Bacteria | 2456 |
| 1007 | Ga0495612_0044444 | 3300053078 | Unclassified | 1818 |
| 1008 | Ga0495612_0098517 | 3300053078 | Bacteria | 1243 |
| 1009 | Ga0495612_0171175 | 3300053078 | Unclassified | 951 |
| 1010 | Ga0495612_0250525 | 3300053078 | Unclassified | 788 |
| 1011 | Ga0495619_0190933 | 3300053085 | Unclassified | 1418 |
| 1012 | Ga0495619_0300298 | 3300053085 | Unclassified | 1112 |
| 1013 | Ga0501084_0399363 | 3300054114 | Unclassified | 1162 |
| 1014 | Ga0587084_046567 | 3300059477 | Unclassified | 755 |
| 1015 | Ga0587066_010893 | 3300059490 | Bacteria | 1322 |
| 1016 | Ga0587083_0014262 | 3300059505 | Bacteria | 1366 |
| 1017 | Ga0587083_0033283 | 3300059505 | Unclassified | 1039 |
| 1018 | Ga0587076_043898 | 3300059645 | Unclassified | 846 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031090 | Ga0265760_10012223 | Ga0265760_100122232 | 153 |
| 2 | 3300005434 | Ga0070709_10023873 | Ga0070709_100238733 | 164 |
| 3 | 3300025906 | Ga0207699_10027939 | Ga0207699_100279393 | 164 |
| 4 | 3300025928 | Ga0207700_10117120 | Ga0207700_101171202 | 164 |
| 5 | 3300028800 | Ga0265338_10010465 | Ga0265338_100104657 | 165 |
| 6 | 3300031249 | Ga0265339_10124375 | Ga0265339_101243752 | 165 |
| 7 | 3300030836 | Ga0265767_104246 | Ga0265767_1042462 | 166 |
| 8 | 3300033545 | Ga0316214_1002952 | Ga0316214_10029523 | 166 |
| 9 | 3300013104 | Ga0157370_10297528 | Ga0157370_102975282 | 176 |
| 10 | 3300005468 | Ga0070707_100300742 | Ga0070707_1003007422 | 182 |
| 11 | 3300025914 | Ga0207671_10851151 | Ga0207671_108511511 | 183 |
| 12 | 3300004801 | Ga0058860_11978086 | Ga0058860_119780862 | 184 |
| 13 | 3300005334 | Ga0068869_100038435 | Ga0068869_1000384354 | 184 |
| 14 | 3300005338 | Ga0068868_100083073 | Ga0068868_1000830732 | 184 |
| 15 | 3300005340 | Ga0070689_100438618 | Ga0070689_1004386181 | 184 |
| 16 | 3300005344 | Ga0070661_100433625 | Ga0070661_1004336252 | 184 |
| 17 | 3300005354 | Ga0070675_100403856 | Ga0070675_1004038562 | 184 |
| 18 | 3300005367 | Ga0070667_100744516 | Ga0070667_1007445161 | 184 |
| 19 | 3300005445 | Ga0070708_100005568 | Ga0070708_10000556810 | 184 |
| 20 | 3300005539 | Ga0068853_100077536 | Ga0068853_1000775364 | 184 |
| 21 | 3300005563 | Ga0068855_100222675 | Ga0068855_1002226751 | 184 |
| 22 | 3300005718 | Ga0068866_10021829 | Ga0068866_100218294 | 184 |
| 23 | 3300005841 | Ga0068863_100038509 | Ga0068863_1000385092 | 184 |
| 24 | 3300005842 | Ga0068858_100702272 | Ga0068858_1007022722 | 184 |
| 25 | 3300005843 | Ga0068860_100024585 | Ga0068860_1000245856 | 184 |
| 26 | 3300005844 | Ga0068862_100154125 | Ga0068862_1001541253 | 184 |
| 27 | 3300005983 | Ga0081540_1060056 | Ga0081540_10600562 | 184 |
| 28 | 3300005983 | Ga0081540_1079668 | Ga0081540_10796682 | 184 |
| 29 | 3300006028 | Ga0070717_10016710 | Ga0070717_100167108 | 184 |
| 30 | 3300006173 | Ga0070716_100291271 | Ga0070716_1002912712 | 184 |
| 31 | 3300006237 | Ga0097621_100131172 | Ga0097621_1001311722 | 184 |
| 32 | 3300006881 | Ga0068865_100008049 | Ga0068865_1000080492 | 184 |
| 33 | 3300009101 | Ga0105247_10766230 | Ga0105247_107662301 | 184 |
| 34 | 3300009176 | Ga0105242_11054714 | Ga0105242_110547142 | 184 |
| 35 | 3300009177 | Ga0105248_10168518 | Ga0105248_101685183 | 184 |
| 36 | 3300009545 | Ga0105237_11498039 | Ga0105237_114980391 | 184 |
| 37 | 3300010375 | Ga0105239_10009528 | Ga0105239_100095281 | 184 |
| 38 | 3300013102 | Ga0157371_10405826 | Ga0157371_104058262 | 184 |
| 39 | 3300013296 | Ga0157374_10007625 | Ga0157374_100076257 | 184 |
| 40 | 3300013306 | Ga0163162_10018901 | Ga0163162_100189016 | 184 |
| 41 | 3300013308 | Ga0157375_10100161 | Ga0157375_101001612 | 184 |
| 42 | 3300014968 | Ga0157379_10117922 | Ga0157379_101179223 | 184 |
| 43 | 3300014969 | Ga0157376_10257624 | Ga0157376_102576242 | 184 |
| 44 | 3300015265 | Ga0182005_1038296 | Ga0182005_10382962 | 184 |
| 45 | 3300025899 | Ga0207642_10110717 | Ga0207642_101107172 | 184 |
| 46 | 3300025904 | Ga0207647_10006770 | Ga0207647_100067707 | 184 |
| 47 | 3300025914 | Ga0207671_10641769 | Ga0207671_106417691 | 184 |
| 48 | 3300025934 | Ga0207686_10432009 | Ga0207686_104320092 | 184 |
| 49 | 3300025938 | Ga0207704_10006939 | Ga0207704_100069396 | 184 |
| 50 | 3300025939 | Ga0207665_10235104 | Ga0207665_102351042 | 184 |
| 51 | 3300025942 | Ga0207689_10000166 | Ga0207689_100001662 | 184 |
| 52 | 3300025986 | Ga0207658_10673197 | Ga0207658_106731972 | 184 |
| 53 | 3300026023 | Ga0207677_10315951 | Ga0207677_103159512 | 184 |
| 54 | 3300026035 | Ga0207703_10005501 | Ga0207703_100055013 | 184 |
| 55 | 3300026035 | Ga0207703_10572438 | Ga0207703_105724382 | 184 |
| 56 | 3300026041 | Ga0207639_10796705 | Ga0207639_107967051 | 184 |
| 57 | 3300026088 | Ga0207641_10040915 | Ga0207641_100409156 | 184 |
| 58 | 3300026088 | Ga0207641_10176197 | Ga0207641_101761971 | 184 |
| 59 | 3300026142 | Ga0207698_10245530 | Ga0207698_102455302 | 184 |
| 60 | 3300045051 | Ga0451576_0987032 | Ga0451576_0987032_179_736 | 184 |
| 61 | 3300046691 | Ga0495670_0112837 | Ga0495670_0112837_279_836 | 184 |
| 62 | 3300048915 | Ga0496112_0001076 | Ga0496112_0001076_16787_17344 | 184 |
| 63 | 3300049460 | Ga0495682_0174605 | Ga0495682_0174605_67_624 | 184 |
| 64 | 3300059477 | Ga0587084_046567 | Ga0587084_046567_162_719 | 184 |
| 65 | 3300059645 | Ga0587076_043898 | Ga0587076_043898_43_600 | 184 |
| 66 | 3300004799 | Ga0058863_11541540 | Ga0058863_115415402 | 185 |
| 67 | 3300004800 | Ga0058861_11967417 | Ga0058861_119674172 | 185 |
| 68 | 3300004803 | Ga0058862_12820738 | Ga0058862_128207381 | 185 |
| 69 | 3300005328 | Ga0070676_10105639 | Ga0070676_101056392 | 185 |
| 70 | 3300005329 | Ga0070683_100056407 | Ga0070683_1000564075 | 185 |
| 71 | 3300005329 | Ga0070683_100109583 | Ga0070683_1001095831 | 185 |
| 72 | 3300005330 | Ga0070690_100149109 | Ga0070690_1001491092 | 185 |
| 73 | 3300005331 | Ga0070670_100008946 | Ga0070670_1000089467 | 185 |
| 74 | 3300005334 | Ga0068869_100029232 | Ga0068869_1000292323 | 185 |
| 75 | 3300005336 | Ga0070680_100106362 | Ga0070680_1001063622 | 185 |
| 76 | 3300005338 | Ga0068868_100037844 | Ga0068868_1000378443 | 185 |
| 77 | 3300005338 | Ga0068868_100057200 | Ga0068868_1000572006 | 185 |
| 78 | 3300005341 | Ga0070691_10107415 | Ga0070691_101074152 | 185 |
| 79 | 3300005344 | Ga0070661_100546227 | Ga0070661_1005462271 | 185 |
| 80 | 3300005364 | Ga0070673_100042242 | Ga0070673_1000422422 | 185 |
| 81 | 3300005366 | Ga0070659_100700216 | Ga0070659_1007002162 | 185 |
| 82 | 3300005434 | Ga0070709_10508767 | Ga0070709_105087671 | 185 |
| 83 | 3300005435 | Ga0070714_100000801 | Ga0070714_1000008015 | 185 |
| 84 | 3300005435 | Ga0070714_100097891 | Ga0070714_1000978911 | 185 |
| 85 | 3300005435 | Ga0070714_100244840 | Ga0070714_1002448402 | 185 |
| 86 | 3300005435 | Ga0070714_100257715 | Ga0070714_1002577152 | 185 |
| 87 | 3300005435 | Ga0070714_100448607 | Ga0070714_1004486072 | 185 |
| 88 | 3300005436 | Ga0070713_100164175 | Ga0070713_1001641752 | 185 |
| 89 | 3300005436 | Ga0070713_100168656 | Ga0070713_1001686562 | 185 |
| 90 | 3300005436 | Ga0070713_100329561 | Ga0070713_1003295612 | 185 |
| 91 | 3300005436 | Ga0070713_100917487 | Ga0070713_1009174871 | 185 |
| 92 | 3300005437 | Ga0070710_10021673 | Ga0070710_100216732 | 185 |
| 93 | 3300005437 | Ga0070710_10082745 | Ga0070710_100827452 | 185 |
| 94 | 3300005437 | Ga0070710_10262749 | Ga0070710_102627492 | 185 |
| 95 | 3300005439 | Ga0070711_100030092 | Ga0070711_1000300923 | 185 |
| 96 | 3300005439 | Ga0070711_100174826 | Ga0070711_1001748262 | 185 |
| 97 | 3300005440 | Ga0070705_100067854 | Ga0070705_1000678542 | 185 |
| 98 | 3300005457 | Ga0070662_100606752 | Ga0070662_1006067522 | 185 |
| 99 | 3300005458 | Ga0070681_10000026 | Ga0070681_1000002670 | 185 |
| 100 | 3300005458 | Ga0070681_10003878 | Ga0070681_100038789 | 185 |
| 101 | 3300005459 | Ga0068867_100026637 | Ga0068867_1000266373 | 185 |
| 102 | 3300005468 | Ga0070707_100053245 | Ga0070707_1000532452 | 185 |
| 103 | 3300005530 | Ga0070679_100028646 | Ga0070679_1000286461 | 185 |
| 104 | 3300005530 | Ga0070679_100051762 | Ga0070679_1000517622 | 185 |
| 105 | 3300005535 | Ga0070684_100069961 | Ga0070684_1000699614 | 185 |
| 106 | 3300005535 | Ga0070684_100121704 | Ga0070684_1001217043 | 185 |
| 107 | 3300005539 | Ga0068853_100006912 | Ga0068853_1000069126 | 185 |
| 108 | 3300005539 | Ga0068853_100064187 | Ga0068853_1000641873 | 185 |
| 109 | 3300005539 | Ga0068853_100317779 | Ga0068853_1003177792 | 185 |
| 110 | 3300005543 | Ga0070672_100572206 | Ga0070672_1005722062 | 185 |
| 111 | 3300005547 | Ga0070693_100072316 | Ga0070693_1000723163 | 185 |
| 112 | 3300005563 | Ga0068855_100000295 | Ga0068855_10000029525 | 185 |
| 113 | 3300005563 | Ga0068855_100043827 | Ga0068855_1000438276 | 185 |
| 114 | 3300005563 | Ga0068855_100054917 | Ga0068855_1000549172 | 185 |
| 115 | 3300005563 | Ga0068855_100139353 | Ga0068855_1001393531 | 185 |
| 116 | 3300005563 | Ga0068855_100373419 | Ga0068855_1003734192 | 185 |
| 117 | 3300005564 | Ga0070664_100000687 | Ga0070664_10000068719 | 185 |
| 118 | 3300005577 | Ga0068857_100001872 | Ga0068857_10000187214 | 185 |
| 119 | 3300005577 | Ga0068857_100010663 | Ga0068857_1000106638 | 185 |
| 120 | 3300005578 | Ga0068854_100023329 | Ga0068854_1000233295 | 185 |
| 121 | 3300005578 | Ga0068854_100028511 | Ga0068854_1000285116 | 185 |
| 122 | 3300005578 | Ga0068854_100050952 | Ga0068854_1000509523 | 185 |
| 123 | 3300005578 | Ga0068854_100754427 | Ga0068854_1007544271 | 185 |
| 124 | 3300005614 | Ga0068856_100000407 | Ga0068856_10000040716 | 185 |
| 125 | 3300005614 | Ga0068856_100000574 | Ga0068856_1000005741 | 185 |
| 126 | 3300005614 | Ga0068856_100002064 | Ga0068856_1000020643 | 185 |
| 127 | 3300005614 | Ga0068856_100006032 | Ga0068856_1000060329 | 185 |
| 128 | 3300005614 | Ga0068856_100009749 | Ga0068856_1000097494 | 185 |
| 129 | 3300005614 | Ga0068856_100193997 | Ga0068856_1001939972 | 185 |
| 130 | 3300005616 | Ga0068852_100007670 | Ga0068852_1000076706 | 185 |
| 131 | 3300005616 | Ga0068852_100097203 | Ga0068852_1000972031 | 185 |
| 132 | 3300005616 | Ga0068852_100163911 | Ga0068852_1001639112 | 185 |
| 133 | 3300005616 | Ga0068852_100528851 | Ga0068852_1005288512 | 185 |
| 134 | 3300005617 | Ga0068859_100039953 | Ga0068859_1000399533 | 185 |
| 135 | 3300005618 | Ga0068864_100000684 | Ga0068864_10000068427 | 185 |
| 136 | 3300005618 | Ga0068864_100079900 | Ga0068864_1000799002 | 185 |
| 137 | 3300005718 | Ga0068866_10022138 | Ga0068866_100221382 | 185 |
| 138 | 3300005840 | Ga0068870_10037683 | Ga0068870_100376832 | 185 |
| 139 | 3300005841 | Ga0068863_100012509 | Ga0068863_1000125094 | 185 |
| 140 | 3300005841 | Ga0068863_100186987 | Ga0068863_1001869872 | 185 |
| 141 | 3300005842 | Ga0068858_100003346 | Ga0068858_1000033465 | 185 |
| 142 | 3300005842 | Ga0068858_100197436 | Ga0068858_1001974362 | 185 |
| 143 | 3300005843 | Ga0068860_100035179 | Ga0068860_1000351792 | 185 |
| 144 | 3300006028 | Ga0070717_10191634 | Ga0070717_101916343 | 185 |
| 145 | 3300006028 | Ga0070717_10202152 | Ga0070717_102021523 | 185 |
| 146 | 3300006028 | Ga0070717_10473219 | Ga0070717_104732192 | 185 |
| 147 | 3300006173 | Ga0070716_100009551 | Ga0070716_1000095517 | 185 |
| 148 | 3300006173 | Ga0070716_100040899 | Ga0070716_1000408992 | 185 |
| 149 | 3300006175 | Ga0070712_100001820 | Ga0070712_10000182011 | 185 |
| 150 | 3300006175 | Ga0070712_100089564 | Ga0070712_1000895643 | 185 |
| 151 | 3300006237 | Ga0097621_100000237 | Ga0097621_10000023717 | 185 |
| 152 | 3300006237 | Ga0097621_100078861 | Ga0097621_1000788611 | 185 |
| 153 | 3300006358 | Ga0068871_100001254 | Ga0068871_10000125416 | 185 |
| 154 | 3300006358 | Ga0068871_100003099 | Ga0068871_1000030995 | 185 |
| 155 | 3300006358 | Ga0068871_100017377 | Ga0068871_1000173773 | 185 |
| 156 | 3300006881 | Ga0068865_100024968 | Ga0068865_1000249685 | 185 |
| 157 | 3300006914 | Ga0075436_100002468 | Ga0075436_1000024689 | 185 |
| 158 | 3300006931 | Ga0097620_100039953 | Ga0097620_1000399534 | 185 |
| 159 | 3300007076 | Ga0075435_100052825 | Ga0075435_1000528252 | 185 |
| 160 | 3300009093 | Ga0105240_10007038 | Ga0105240_100070385 | 185 |
| 161 | 3300009093 | Ga0105240_10063883 | Ga0105240_100638832 | 185 |
| 162 | 3300009093 | Ga0105240_10078754 | Ga0105240_100787542 | 185 |
| 163 | 3300009093 | Ga0105240_11125776 | Ga0105240_111257761 | 185 |
| 164 | 3300009098 | Ga0105245_10322498 | Ga0105245_103224982 | 185 |
| 165 | 3300009148 | Ga0105243_10295434 | Ga0105243_102954342 | 185 |
| 166 | 3300009174 | Ga0105241_10000910 | Ga0105241_1000091017 | 185 |
| 167 | 3300009174 | Ga0105241_10034557 | Ga0105241_100345573 | 185 |
| 168 | 3300009174 | Ga0105241_10086055 | Ga0105241_100860553 | 185 |
| 169 | 3300009174 | Ga0105241_10122990 | Ga0105241_101229902 | 185 |
| 170 | 3300009174 | Ga0105241_10429685 | Ga0105241_104296852 | 185 |
| 171 | 3300009177 | Ga0105248_10013380 | Ga0105248_100133806 | 185 |
| 172 | 3300009177 | Ga0105248_10077736 | Ga0105248_100777363 | 185 |
| 173 | 3300009177 | Ga0105248_10344950 | Ga0105248_103449501 | 185 |
| 174 | 3300009545 | Ga0105237_10022977 | Ga0105237_100229773 | 185 |
| 175 | 3300009545 | Ga0105237_11027503 | Ga0105237_110275031 | 185 |
| 176 | 3300009551 | Ga0105238_10000188 | Ga0105238_100001881 | 185 |
| 177 | 3300009551 | Ga0105238_10016920 | Ga0105238_100169204 | 185 |
| 178 | 3300010375 | Ga0105239_10059067 | Ga0105239_100590676 | 185 |
| 179 | 3300013100 | Ga0157373_10001291 | Ga0157373_100012919 | 185 |
| 180 | 3300013100 | Ga0157373_10106830 | Ga0157373_101068302 | 185 |
| 181 | 3300013100 | Ga0157373_10135455 | Ga0157373_101354552 | 185 |
| 182 | 3300013102 | Ga0157371_10603082 | Ga0157371_106030821 | 185 |
| 183 | 3300013104 | Ga0157370_10011537 | Ga0157370_100115373 | 185 |
| 184 | 3300013104 | Ga0157370_10025983 | Ga0157370_100259835 | 185 |
| 185 | 3300013105 | Ga0157369_10000124 | Ga0157369_1000012476 | 185 |
| 186 | 3300013105 | Ga0157369_10013546 | Ga0157369_100135462 | 185 |
| 187 | 3300013105 | Ga0157369_10026095 | Ga0157369_100260952 | 185 |
| 188 | 3300013105 | Ga0157369_10059396 | Ga0157369_100593963 | 185 |
| 189 | 3300013105 | Ga0157369_10115306 | Ga0157369_101153064 | 185 |
| 190 | 3300013296 | Ga0157374_10000162 | Ga0157374_1000016220 | 185 |
| 191 | 3300013296 | Ga0157374_10000582 | Ga0157374_100005821 | 185 |
| 192 | 3300013296 | Ga0157374_10002038 | Ga0157374_1000203816 | 185 |
| 193 | 3300013296 | Ga0157374_10053221 | Ga0157374_100532213 | 185 |
| 194 | 3300013296 | Ga0157374_11442313 | Ga0157374_114423131 | 185 |
| 195 | 3300013297 | Ga0157378_10000020 | Ga0157378_1000002054 | 185 |
| 196 | 3300013297 | Ga0157378_10000320 | Ga0157378_1000032016 | 185 |
| 197 | 3300013297 | Ga0157378_10003732 | Ga0157378_100037327 | 185 |
| 198 | 3300013307 | Ga0157372_10000084 | Ga0157372_1000008461 | 185 |
| 199 | 3300013307 | Ga0157372_10001092 | Ga0157372_1000109226 | 185 |
| 200 | 3300013307 | Ga0157372_10001112 | Ga0157372_100011124 | 185 |
| 201 | 3300013307 | Ga0157372_10007677 | Ga0157372_100076775 | 185 |
| 202 | 3300013307 | Ga0157372_10030884 | Ga0157372_100308842 | 185 |
| 203 | 3300013307 | Ga0157372_10035192 | Ga0157372_100351927 | 185 |
| 204 | 3300013307 | Ga0157372_10055764 | Ga0157372_100557644 | 185 |
| 205 | 3300013307 | Ga0157372_10212864 | Ga0157372_102128643 | 185 |
| 206 | 3300013307 | Ga0157372_10340278 | Ga0157372_103402782 | 185 |
| 207 | 3300013307 | Ga0157372_10429140 | Ga0157372_104291402 | 185 |
| 208 | 3300014969 | Ga0157376_10001784 | Ga0157376_1000178412 | 185 |
| 209 | 3300014969 | Ga0157376_10001794 | Ga0157376_100017941 | 185 |
| 210 | 3300020080 | Ga0206350_11157382 | Ga0206350_111573825 | 185 |
| 211 | 3300021377 | Ga0213874_10071993 | Ga0213874_100719932 | 185 |
| 212 | 3300022467 | Ga0224712_10097972 | Ga0224712_100979721 | 185 |
| 213 | 3300025898 | Ga0207692_10076629 | Ga0207692_100766293 | 185 |
| 214 | 3300025898 | Ga0207692_10102483 | Ga0207692_101024833 | 185 |
| 215 | 3300025898 | Ga0207692_10303501 | Ga0207692_103035012 | 185 |
| 216 | 3300025899 | Ga0207642_10014085 | Ga0207642_100140853 | 185 |
| 217 | 3300025904 | Ga0207647_10031767 | Ga0207647_100317672 | 185 |
| 218 | 3300025906 | Ga0207699_10015704 | Ga0207699_100157045 | 185 |
| 219 | 3300025906 | Ga0207699_10491468 | Ga0207699_104914682 | 185 |
| 220 | 3300025908 | Ga0207643_10157106 | Ga0207643_101571061 | 185 |
| 221 | 3300025911 | Ga0207654_10036475 | Ga0207654_100364752 | 185 |
| 222 | 3300025911 | Ga0207654_10069633 | Ga0207654_100696332 | 185 |
| 223 | 3300025911 | Ga0207654_10317364 | Ga0207654_103173642 | 185 |
| 224 | 3300025911 | Ga0207654_10535023 | Ga0207654_105350232 | 185 |
| 225 | 3300025912 | Ga0207707_10000800 | Ga0207707_1000080015 | 185 |
| 226 | 3300025912 | Ga0207707_10008961 | Ga0207707_100089618 | 185 |
| 227 | 3300025912 | Ga0207707_10064483 | Ga0207707_100644831 | 185 |
| 228 | 3300025913 | Ga0207695_10018259 | Ga0207695_100182597 | 185 |
| 229 | 3300025913 | Ga0207695_10028234 | Ga0207695_100282342 | 185 |
| 230 | 3300025913 | Ga0207695_10049830 | Ga0207695_100498307 | 185 |
| 231 | 3300025913 | Ga0207695_10206897 | Ga0207695_102068973 | 185 |
| 232 | 3300025913 | Ga0207695_10475059 | Ga0207695_104750592 | 185 |
| 233 | 3300025914 | Ga0207671_10246618 | Ga0207671_102466182 | 185 |
| 234 | 3300025914 | Ga0207671_10522239 | Ga0207671_105222391 | 185 |
| 235 | 3300025915 | Ga0207693_10008124 | Ga0207693_100081243 | 185 |
| 236 | 3300025915 | Ga0207693_10015084 | Ga0207693_100150845 | 185 |
| 237 | 3300025916 | Ga0207663_10009352 | Ga0207663_100093523 | 185 |
| 238 | 3300025916 | Ga0207663_10365848 | Ga0207663_103658482 | 185 |
| 239 | 3300025917 | Ga0207660_10019266 | Ga0207660_100192666 | 185 |
| 240 | 3300025917 | Ga0207660_10432805 | Ga0207660_104328052 | 185 |
| 241 | 3300025920 | Ga0207649_10551739 | Ga0207649_105517391 | 185 |
| 242 | 3300025921 | Ga0207652_10052324 | Ga0207652_100523242 | 185 |
| 243 | 3300025921 | Ga0207652_10253362 | Ga0207652_102533623 | 185 |
| 244 | 3300025924 | Ga0207694_10000434 | Ga0207694_1000043435 | 185 |
| 245 | 3300025925 | Ga0207650_10045927 | Ga0207650_100459273 | 185 |
| 246 | 3300025927 | Ga0207687_10315703 | Ga0207687_103157032 | 185 |
| 247 | 3300025928 | Ga0207700_10008553 | Ga0207700_100085537 | 185 |
| 248 | 3300025928 | Ga0207700_10009126 | Ga0207700_100091263 | 185 |
| 249 | 3300025928 | Ga0207700_10083494 | Ga0207700_100834943 | 185 |
| 250 | 3300025928 | Ga0207700_10115398 | Ga0207700_101153982 | 185 |
| 251 | 3300025928 | Ga0207700_10276955 | Ga0207700_102769552 | 185 |
| 252 | 3300025928 | Ga0207700_10742627 | Ga0207700_107426272 | 185 |
| 253 | 3300025929 | Ga0207664_10013520 | Ga0207664_100135207 | 185 |
| 254 | 3300025929 | Ga0207664_10242000 | Ga0207664_102420002 | 185 |
| 255 | 3300025929 | Ga0207664_10566030 | Ga0207664_105660302 | 185 |
| 256 | 3300025929 | Ga0207664_11210940 | Ga0207664_112109401 | 185 |
| 257 | 3300025932 | Ga0207690_10253114 | Ga0207690_102531142 | 185 |
| 258 | 3300025933 | Ga0207706_10097987 | Ga0207706_100979872 | 185 |
| 259 | 3300025935 | Ga0207709_10187376 | Ga0207709_101873762 | 185 |
| 260 | 3300025938 | Ga0207704_10085128 | Ga0207704_100851282 | 185 |
| 261 | 3300025939 | Ga0207665_10030987 | Ga0207665_100309875 | 185 |
| 262 | 3300025939 | Ga0207665_10214247 | Ga0207665_102142472 | 185 |
| 263 | 3300025940 | Ga0207691_10545967 | Ga0207691_105459671 | 185 |
| 264 | 3300025941 | Ga0207711_10004283 | Ga0207711_100042838 | 185 |
| 265 | 3300025941 | Ga0207711_10386704 | Ga0207711_103867042 | 185 |
| 266 | 3300025941 | Ga0207711_10730866 | Ga0207711_107308662 | 185 |
| 267 | 3300025942 | Ga0207689_10046784 | Ga0207689_100467842 | 185 |
| 268 | 3300025944 | Ga0207661_10087290 | Ga0207661_100872902 | 185 |
| 269 | 3300025944 | Ga0207661_10119206 | Ga0207661_101192061 | 185 |
| 270 | 3300025945 | Ga0207679_10004667 | Ga0207679_100046675 | 185 |
| 271 | 3300025945 | Ga0207679_10062735 | Ga0207679_100627353 | 185 |
| 272 | 3300025949 | Ga0207667_10000213 | Ga0207667_1000021312 | 185 |
| 273 | 3300025949 | Ga0207667_10003075 | Ga0207667_100030753 | 185 |
| 274 | 3300025949 | Ga0207667_10265135 | Ga0207667_102651352 | 185 |
| 275 | 3300025949 | Ga0207667_10394207 | Ga0207667_103942071 | 185 |
| 276 | 3300025960 | Ga0207651_10168669 | Ga0207651_101686692 | 185 |
| 277 | 3300025981 | Ga0207640_10016573 | Ga0207640_100165735 | 185 |
| 278 | 3300025981 | Ga0207640_10032474 | Ga0207640_100324742 | 185 |
| 279 | 3300025981 | Ga0207640_10726855 | Ga0207640_107268551 | 185 |
| 280 | 3300026023 | Ga0207677_10089122 | Ga0207677_100891223 | 185 |
| 281 | 3300026023 | Ga0207677_10875546 | Ga0207677_108755462 | 185 |
| 282 | 3300026035 | Ga0207703_10225667 | Ga0207703_102256672 | 185 |
| 283 | 3300026035 | Ga0207703_10628668 | Ga0207703_106286682 | 185 |
| 284 | 3300026041 | Ga0207639_10034997 | Ga0207639_100349973 | 185 |
| 285 | 3300026041 | Ga0207639_10052098 | Ga0207639_100520982 | 185 |
| 286 | 3300026041 | Ga0207639_10766067 | Ga0207639_107660671 | 185 |
| 287 | 3300026078 | Ga0207702_10000114 | Ga0207702_1000011424 | 185 |
| 288 | 3300026078 | Ga0207702_10001495 | Ga0207702_100014954 | 185 |
| 289 | 3300026078 | Ga0207702_10007437 | Ga0207702_100074374 | 185 |
| 290 | 3300026088 | Ga0207641_10044284 | Ga0207641_100442843 | 185 |
| 291 | 3300026089 | Ga0207648_10059874 | Ga0207648_100598743 | 185 |
| 292 | 3300026089 | Ga0207648_11166450 | Ga0207648_111664501 | 185 |
| 293 | 3300026095 | Ga0207676_10002123 | Ga0207676_100021235 | 185 |
| 294 | 3300026095 | Ga0207676_10036414 | Ga0207676_100364143 | 185 |
| 295 | 3300026116 | Ga0207674_10000860 | Ga0207674_100008605 | 185 |
| 296 | 3300026116 | Ga0207674_10001389 | Ga0207674_1000138928 | 185 |
| 297 | 3300026121 | Ga0207683_10231082 | Ga0207683_102310822 | 185 |
| 298 | 3300026142 | Ga0207698_10007054 | Ga0207698_100070544 | 185 |
| 299 | 3300026142 | Ga0207698_10145340 | Ga0207698_101453403 | 185 |
| 300 | 3300026142 | Ga0207698_10878364 | Ga0207698_108783642 | 185 |
| 301 | 3300028381 | Ga0268264_10054667 | Ga0268264_100546672 | 185 |
| 302 | 3300035111 | Ga0373923_0044959 | Ga0373923_0044959_832_1401 | 185 |
| 303 | 3300035113 | Ga0373936_0004143 | Ga0373936_0004143_190_759 | 185 |
| 304 | 3300035116 | Ga0373945_0033738 | Ga0373945_0033738_479_1048 | 185 |
| 305 | 3300035170 | Ga0373943_0336782 | Ga0373943_0336782_123_719 | 185 |
| 306 | 3300035170 | Ga0373943_0491519 | Ga0373943_0491519_62_631 | 185 |
| 307 | 3300035171 | Ga0373946_0027897 | Ga0373946_0027897_842_1411 | 185 |
| 308 | 3300035207 | Ga0373942_0083517 | Ga0373942_0083517_143_739 | 185 |
| 309 | 3300035691 | Ga0373931_0224926 | Ga0373931_0224926_59_655 | 185 |
| 310 | 3300035692 | Ga0373935_0042141 | Ga0373935_0042141_813_1382 | 185 |
| 311 | 3300035692 | Ga0373935_0088933 | Ga0373935_0088933_1313_1882 | 185 |
| 312 | 3300035695 | Ga0373927_0009726 | Ga0373927_0009726_916_1485 | 185 |
| 313 | 3300035695 | Ga0373927_0066421 | Ga0373927_0066421_1392_1988 | 185 |
| 314 | 3300035724 | Ga0373933_0039974 | Ga0373933_0039974_1049_1618 | 185 |
| 315 | 3300035724 | Ga0373933_0413017 | Ga0373933_0413017_70_666 | 185 |
| 316 | 3300035725 | Ga0373947_0004931 | Ga0373947_0004931_2550_3119 | 185 |
| 317 | 3300036401 | Ga0373937_0019513 | Ga0373937_0019513_478_1074 | 185 |
| 318 | 3300036401 | Ga0373937_0064885 | Ga0373937_0064885_1430_1999 | 185 |
| 319 | 3300037068 | Ga0373925_0003931 | Ga0373925_0003931_1652_2248 | 185 |
| 320 | 3300037068 | Ga0373925_0014525 | Ga0373925_0014525_4016_4585 | 185 |
| 321 | 3300037068 | Ga0373925_0079427 | Ga0373925_0079427_285_854 | 185 |
| 322 | 3300037068 | Ga0373925_0167640 | Ga0373925_0167640_1030_1599 | 185 |
| 323 | 3300037853 | Ga0436364_1110329 | Ga0436364_1110329_1186_1779 | 185 |
| 324 | 3300044683 | Ga0466965_0088475 | Ga0466965_0088475_120_716 | 185 |
| 325 | 3300044693 | Ga0466961_0140333 | Ga0466961_0140333_107_703 | 185 |
| 326 | 3300044694 | Ga0466963_0139862 | Ga0466963_0139862_790_1386 | 185 |
| 327 | 3300044719 | Ga0466971_0084679 | Ga0466971_0084679_741_1337 | 185 |
| 328 | 3300044842 | Ga0466957_0222445 | Ga0466957_0222445_281_877 | 185 |
| 329 | 3300045049 | Ga0466959_0440776 | Ga0466959_0440776_21_617 | 185 |
| 330 | 3300045051 | Ga0451576_1280470 | Ga0451576_1280470_144_740 | 185 |
| 331 | 3300045836 | Ga0466958_0247231 | Ga0466958_0247231_58_654 | 185 |
| 332 | 3300045976 | Ga0466967_0069816 | Ga0466967_0069816_679_1275 | 185 |
| 333 | 3300046463 | Ga0495653_0402536 | Ga0495653_0402536_126_695 | 185 |
| 334 | 3300046472 | Ga0495580_0000068 | Ga0495580_0000068_25919_26515 | 185 |
| 335 | 3300046472 | Ga0495580_0048399 | Ga0495580_0048399_1691_2260 | 185 |
| 336 | 3300046472 | Ga0495580_0283368 | Ga0495580_0283368_273_842 | 185 |
| 337 | 3300046473 | Ga0495582_0000291 | Ga0495582_0000291_15211_15780 | 185 |
| 338 | 3300046517 | Ga0495630_0112947 | Ga0495630_0112947_671_1267 | 185 |
| 339 | 3300046526 | Ga0495666_0046554 | Ga0495666_0046554_194_763 | 185 |
| 340 | 3300046531 | Ga0495665_0026314 | Ga0495665_0026314_1664_2233 | 185 |
| 341 | 3300046531 | Ga0495665_0129909 | Ga0495665_0129909_277_873 | 185 |
| 342 | 3300046531 | Ga0495665_0266268 | Ga0495665_0266268_264_833 | 185 |
| 343 | 3300046535 | Ga0495586_0202657 | Ga0495586_0202657_329_898 | 185 |
| 344 | 3300046536 | Ga0495587_0085692 | Ga0495587_0085692_1059_1655 | 185 |
| 345 | 3300046683 | Ga0495658_0527980 | Ga0495658_0527980_112_681 | 185 |
| 346 | 3300047315 | Ga0495581_0435666 | Ga0495581_0435666_69_665 | 185 |
| 347 | 3300047317 | Ga0495604_0329445 | Ga0495604_0329445_338_934 | 185 |
| 348 | 3300047319 | Ga0495674_0103640 | Ga0495674_0103640_1777_2346 | 185 |
| 349 | 3300047444 | Ga0495675_0058923 | Ga0495675_0058923_1055_1651 | 185 |
| 350 | 3300047471 | Ga0495684_0501770 | Ga0495684_0501770_72_668 | 185 |
| 351 | 3300048088 | Ga0495602_0305789 | Ga0495602_0305789_234_830 | 185 |
| 352 | 3300048903 | Ga0496100_0488136 | Ga0496100_0488136_19_615 | 185 |
| 353 | 3300048903 | Ga0496100_0937622 | Ga0496100_0937622_25_594 | 185 |
| 354 | 3300048905 | Ga0496102_0340715 | Ga0496102_0340715_147_743 | 185 |
| 355 | 3300048905 | Ga0496102_0412569 | Ga0496102_0412569_125_721 | 185 |
| 356 | 3300048907 | Ga0496104_0065831 | Ga0496104_0065831_1291_1860 | 185 |
| 357 | 3300048908 | Ga0496105_0275814 | Ga0496105_0275814_366_962 | 185 |
| 358 | 3300048913 | Ga0496110_0734514 | Ga0496110_0734514_256_852 | 185 |
| 359 | 3300048915 | Ga0496112_0010933 | Ga0496112_0010933_4292_4888 | 185 |
| 360 | 3300048915 | Ga0496112_0011133 | Ga0496112_0011133_3504_4100 | 185 |
| 361 | 3300048915 | Ga0496112_0218716 | Ga0496112_0218716_655_1251 | 185 |
| 362 | 3300048916 | Ga0496113_0133330 | Ga0496113_0133330_340_936 | 185 |
| 363 | 3300048916 | Ga0496113_0418134 | Ga0496113_0418134_25_621 | 185 |
| 364 | 3300050512 | nmdc:mga0n895_819076_c1 | nmdc:mga0n895_819076_c1_97_693 | 185 |
| 365 | 3300050514 | nmdc:mga08x19_859_c1 | nmdc:mga08x19_859_c1_3378_3947 | 185 |
| 366 | 3300053078 | Ga0495612_0044444 | Ga0495612_0044444_679_1275 | 185 |
| 367 | 3300059505 | Ga0587083_0033283 | Ga0587083_0033283_410_1006 | 185 |
| 368 | 3300002459 | JGI24751J29686_10001273 | JGI24751J29686_100012734 | 186 |
| 369 | 3300004800 | Ga0058861_11821206 | Ga0058861_118212061 | 186 |
| 370 | 3300004803 | Ga0058862_12834571 | Ga0058862_128345711 | 186 |
| 371 | 3300005327 | Ga0070658_10069011 | Ga0070658_100690114 | 186 |
| 372 | 3300005328 | Ga0070676_10004549 | Ga0070676_100045494 | 186 |
| 373 | 3300005329 | Ga0070683_100011357 | Ga0070683_1000113577 | 186 |
| 374 | 3300005330 | Ga0070690_100042518 | Ga0070690_1000425183 | 186 |
| 375 | 3300005331 | Ga0070670_100116293 | Ga0070670_1001162933 | 186 |
| 376 | 3300005334 | Ga0068869_100089885 | Ga0068869_1000898853 | 186 |
| 377 | 3300005334 | Ga0068869_100244958 | Ga0068869_1002449582 | 186 |
| 378 | 3300005335 | Ga0070666_10054046 | Ga0070666_100540463 | 186 |
| 379 | 3300005337 | Ga0070682_100016275 | Ga0070682_1000162752 | 186 |
| 380 | 3300005338 | Ga0068868_100090258 | Ga0068868_1000902582 | 186 |
| 381 | 3300005338 | Ga0068868_100175989 | Ga0068868_1001759892 | 186 |
| 382 | 3300005339 | Ga0070660_100019827 | Ga0070660_1000198274 | 186 |
| 383 | 3300005340 | Ga0070689_100040309 | Ga0070689_1000403092 | 186 |
| 384 | 3300005343 | Ga0070687_100001627 | Ga0070687_1000016277 | 186 |
| 385 | 3300005344 | Ga0070661_100007433 | Ga0070661_1000074337 | 186 |
| 386 | 3300005347 | Ga0070668_100108119 | Ga0070668_1001081192 | 186 |
| 387 | 3300005347 | Ga0070668_100760337 | Ga0070668_1007603371 | 186 |
| 388 | 3300005353 | Ga0070669_100068238 | Ga0070669_1000682381 | 186 |
| 389 | 3300005354 | Ga0070675_100023143 | Ga0070675_1000231434 | 186 |
| 390 | 3300005355 | Ga0070671_100122010 | Ga0070671_1001220102 | 186 |
| 391 | 3300005356 | Ga0070674_100018353 | Ga0070674_1000183533 | 186 |
| 392 | 3300005364 | Ga0070673_100008843 | Ga0070673_1000088432 | 186 |
| 393 | 3300005365 | Ga0070688_100009674 | Ga0070688_1000096742 | 186 |
| 394 | 3300005366 | Ga0070659_100028812 | Ga0070659_1000288122 | 186 |
| 395 | 3300005367 | Ga0070667_100241782 | Ga0070667_1002417822 | 186 |
| 396 | 3300005434 | Ga0070709_10003196 | Ga0070709_100031966 | 186 |
| 397 | 3300005436 | Ga0070713_100000569 | Ga0070713_1000005694 | 186 |
| 398 | 3300005436 | Ga0070713_100242057 | Ga0070713_1002420572 | 186 |
| 399 | 3300005437 | Ga0070710_10010073 | Ga0070710_100100735 | 186 |
| 400 | 3300005439 | Ga0070711_100281402 | Ga0070711_1002814022 | 186 |
| 401 | 3300005444 | Ga0070694_100270029 | Ga0070694_1002700291 | 186 |
| 402 | 3300005445 | Ga0070708_100103449 | Ga0070708_1001034494 | 186 |
| 403 | 3300005455 | Ga0070663_100085535 | Ga0070663_1000855352 | 186 |
| 404 | 3300005457 | Ga0070662_100016025 | Ga0070662_1000160255 | 186 |
| 405 | 3300005458 | Ga0070681_10024591 | Ga0070681_100245915 | 186 |
| 406 | 3300005458 | Ga0070681_10424738 | Ga0070681_104247381 | 186 |
| 407 | 3300005459 | Ga0068867_100018978 | Ga0068867_1000189784 | 186 |
| 408 | 3300005466 | Ga0070685_10000797 | Ga0070685_100007975 | 186 |
| 409 | 3300005467 | Ga0070706_100069319 | Ga0070706_1000693192 | 186 |
| 410 | 3300005468 | Ga0070707_100309713 | Ga0070707_1003097132 | 186 |
| 411 | 3300005471 | Ga0070698_100161985 | Ga0070698_1001619851 | 186 |
| 412 | 3300005530 | Ga0070679_100012185 | Ga0070679_1000121856 | 186 |
| 413 | 3300005535 | Ga0070684_100004113 | Ga0070684_1000041137 | 186 |
| 414 | 3300005536 | Ga0070697_100642296 | Ga0070697_1006422962 | 186 |
| 415 | 3300005539 | Ga0068853_100012490 | Ga0068853_1000124907 | 186 |
| 416 | 3300005543 | Ga0070672_100048312 | Ga0070672_1000483122 | 186 |
| 417 | 3300005563 | Ga0068855_100018006 | Ga0068855_1000180062 | 186 |
| 418 | 3300005564 | Ga0070664_100266771 | Ga0070664_1002667712 | 186 |
| 419 | 3300005577 | Ga0068857_100002428 | Ga0068857_1000024284 | 186 |
| 420 | 3300005577 | Ga0068857_100286927 | Ga0068857_1002869272 | 186 |
| 421 | 3300005578 | Ga0068854_100089977 | Ga0068854_1000899772 | 186 |
| 422 | 3300005614 | Ga0068856_100456165 | Ga0068856_1004561651 | 186 |
| 423 | 3300005616 | Ga0068852_100116779 | Ga0068852_1001167792 | 186 |
| 424 | 3300005718 | Ga0068866_10016537 | Ga0068866_100165372 | 186 |
| 425 | 3300005719 | Ga0068861_100061273 | Ga0068861_1000612733 | 186 |
| 426 | 3300005834 | Ga0068851_10032375 | Ga0068851_100323753 | 186 |
| 427 | 3300005840 | Ga0068870_10014885 | Ga0068870_100148853 | 186 |
| 428 | 3300005841 | Ga0068863_100178505 | Ga0068863_1001785052 | 186 |
| 429 | 3300005842 | Ga0068858_100009627 | Ga0068858_1000096276 | 186 |
| 430 | 3300005843 | Ga0068860_100040235 | Ga0068860_1000402354 | 186 |
| 431 | 3300005844 | Ga0068862_100089621 | Ga0068862_1000896212 | 186 |
| 432 | 3300006028 | Ga0070717_10022998 | Ga0070717_100229983 | 186 |
| 433 | 3300006163 | Ga0070715_10131266 | Ga0070715_101312662 | 186 |
| 434 | 3300006173 | Ga0070716_100013373 | Ga0070716_1000133734 | 186 |
| 435 | 3300006175 | Ga0070712_100000708 | Ga0070712_10000070818 | 186 |
| 436 | 3300006175 | Ga0070712_100173881 | Ga0070712_1001738812 | 186 |
| 437 | 3300006175 | Ga0070712_100996098 | Ga0070712_1009960982 | 186 |
| 438 | 3300006358 | Ga0068871_100199812 | Ga0068871_1001998122 | 186 |
| 439 | 3300006358 | Ga0068871_100361836 | Ga0068871_1003618362 | 186 |
| 440 | 3300006852 | Ga0075433_10067212 | Ga0075433_100672123 | 186 |
| 441 | 3300006852 | Ga0075433_10474415 | Ga0075433_104744152 | 186 |
| 442 | 3300006871 | Ga0075434_100003658 | Ga0075434_1000036589 | 186 |
| 443 | 3300006881 | Ga0068865_100385278 | Ga0068865_1003852782 | 186 |
| 444 | 3300007076 | Ga0075435_100321593 | Ga0075435_1003215931 | 186 |
| 445 | 3300007265 | Ga0099794_10130754 | Ga0099794_101307541 | 186 |
| 446 | 3300009011 | Ga0105251_10187492 | Ga0105251_101874921 | 186 |
| 447 | 3300009092 | Ga0105250_10103101 | Ga0105250_101031011 | 186 |
| 448 | 3300009092 | Ga0105250_10122046 | Ga0105250_101220462 | 186 |
| 449 | 3300009094 | Ga0111539_10415590 | Ga0111539_104155902 | 186 |
| 450 | 3300009098 | Ga0105245_10059246 | Ga0105245_100592463 | 186 |
| 451 | 3300009098 | Ga0105245_10062536 | Ga0105245_100625364 | 186 |
| 452 | 3300009101 | Ga0105247_10001613 | Ga0105247_1000161310 | 186 |
| 453 | 3300009148 | Ga0105243_11132394 | Ga0105243_111323942 | 186 |
| 454 | 3300009174 | Ga0105241_10023344 | Ga0105241_100233442 | 186 |
| 455 | 3300009176 | Ga0105242_10498187 | Ga0105242_104981871 | 186 |
| 456 | 3300009177 | Ga0105248_10023146 | Ga0105248_100231467 | 186 |
| 457 | 3300009553 | Ga0105249_10006286 | Ga0105249_100062862 | 186 |
| 458 | 3300009553 | Ga0105249_10034638 | Ga0105249_100346384 | 186 |
| 459 | 3300010375 | Ga0105239_10080930 | Ga0105239_100809302 | 186 |
| 460 | 3300011119 | Ga0105246_10091932 | Ga0105246_100919321 | 186 |
| 461 | 3300012506 | Ga0157324_1013069 | Ga0157324_10130691 | 186 |
| 462 | 3300013100 | Ga0157373_10013739 | Ga0157373_100137396 | 186 |
| 463 | 3300013102 | Ga0157371_10185360 | Ga0157371_101853602 | 186 |
| 464 | 3300013105 | Ga0157369_10030134 | Ga0157369_100301341 | 186 |
| 465 | 3300013296 | Ga0157374_10239140 | Ga0157374_102391402 | 186 |
| 466 | 3300013296 | Ga0157374_10311953 | Ga0157374_103119532 | 186 |
| 467 | 3300013306 | Ga0163162_10088580 | Ga0163162_100885802 | 186 |
| 468 | 3300013306 | Ga0163162_10469048 | Ga0163162_104690482 | 186 |
| 469 | 3300013307 | Ga0157372_10052890 | Ga0157372_100528902 | 186 |
| 470 | 3300014325 | Ga0163163_10005648 | Ga0163163_100056488 | 186 |
| 471 | 3300014326 | Ga0157380_10017537 | Ga0157380_100175373 | 186 |
| 472 | 3300014745 | Ga0157377_10000230 | Ga0157377_100002309 | 186 |
| 473 | 3300014968 | Ga0157379_10008716 | Ga0157379_100087168 | 186 |
| 474 | 3300014968 | Ga0157379_10462791 | Ga0157379_104627912 | 186 |
| 475 | 3300017792 | Ga0163161_10012941 | Ga0163161_100129414 | 186 |
| 476 | 3300025315 | Ga0207697_10003863 | Ga0207697_100038635 | 186 |
| 477 | 3300025321 | Ga0207656_10019855 | Ga0207656_100198552 | 186 |
| 478 | 3300025898 | Ga0207692_10034448 | Ga0207692_100344481 | 186 |
| 479 | 3300025899 | Ga0207642_10004367 | Ga0207642_100043673 | 186 |
| 480 | 3300025901 | Ga0207688_10014841 | Ga0207688_100148412 | 186 |
| 481 | 3300025903 | Ga0207680_10101778 | Ga0207680_101017782 | 186 |
| 482 | 3300025904 | Ga0207647_10017691 | Ga0207647_100176915 | 186 |
| 483 | 3300025906 | Ga0207699_10000423 | Ga0207699_1000042319 | 186 |
| 484 | 3300025907 | Ga0207645_10000376 | Ga0207645_1000037613 | 186 |
| 485 | 3300025908 | Ga0207643_10000194 | Ga0207643_1000019422 | 186 |
| 486 | 3300025909 | Ga0207705_10046569 | Ga0207705_100465694 | 186 |
| 487 | 3300025911 | Ga0207654_10420364 | Ga0207654_104203641 | 186 |
| 488 | 3300025912 | Ga0207707_10018040 | Ga0207707_100180404 | 186 |
| 489 | 3300025912 | Ga0207707_10499169 | Ga0207707_104991692 | 186 |
| 490 | 3300025915 | Ga0207693_10000024 | Ga0207693_100000241 | 186 |
| 491 | 3300025915 | Ga0207693_10513648 | Ga0207693_105136482 | 186 |
| 492 | 3300025916 | Ga0207663_10350788 | Ga0207663_103507882 | 186 |
| 493 | 3300025917 | Ga0207660_10281806 | Ga0207660_102818062 | 186 |
| 494 | 3300025918 | Ga0207662_10001408 | Ga0207662_100014084 | 186 |
| 495 | 3300025919 | Ga0207657_10010820 | Ga0207657_100108205 | 186 |
| 496 | 3300025920 | Ga0207649_10001260 | Ga0207649_100012602 | 186 |
| 497 | 3300025922 | Ga0207646_10120223 | Ga0207646_101202234 | 186 |
| 498 | 3300025922 | Ga0207646_10749878 | Ga0207646_107498781 | 186 |
| 499 | 3300025925 | Ga0207650_10000216 | Ga0207650_1000021628 | 186 |
| 500 | 3300025925 | Ga0207650_10275198 | Ga0207650_102751982 | 186 |
| 501 | 3300025926 | Ga0207659_10178763 | Ga0207659_101787631 | 186 |
| 502 | 3300025928 | Ga0207700_10025588 | Ga0207700_100255884 | 186 |
| 503 | 3300025928 | Ga0207700_10163626 | Ga0207700_101636262 | 186 |
| 504 | 3300025928 | Ga0207700_10195915 | Ga0207700_101959152 | 186 |
| 505 | 3300025929 | Ga0207664_10293729 | Ga0207664_102937292 | 186 |
| 506 | 3300025931 | Ga0207644_10086751 | Ga0207644_100867513 | 186 |
| 507 | 3300025932 | Ga0207690_10033647 | Ga0207690_100336472 | 186 |
| 508 | 3300025933 | Ga0207706_10032789 | Ga0207706_100327893 | 186 |
| 509 | 3300025936 | Ga0207670_10001554 | Ga0207670_100015548 | 186 |
| 510 | 3300025937 | Ga0207669_10036908 | Ga0207669_100369081 | 186 |
| 511 | 3300025940 | Ga0207691_10000459 | Ga0207691_1000045929 | 186 |
| 512 | 3300025941 | Ga0207711_10002757 | Ga0207711_1000275716 | 186 |
| 513 | 3300025942 | Ga0207689_10001458 | Ga0207689_1000145818 | 186 |
| 514 | 3300025942 | Ga0207689_10135088 | Ga0207689_101350882 | 186 |
| 515 | 3300025944 | Ga0207661_10001667 | Ga0207661_100016679 | 186 |
| 516 | 3300025945 | Ga0207679_10000496 | Ga0207679_1000049624 | 186 |
| 517 | 3300025949 | Ga0207667_10339491 | Ga0207667_103394912 | 186 |
| 518 | 3300025960 | Ga0207651_10064958 | Ga0207651_100649583 | 186 |
| 519 | 3300025961 | Ga0207712_10021189 | Ga0207712_100211892 | 186 |
| 520 | 3300025972 | Ga0207668_10169345 | Ga0207668_101693452 | 186 |
| 521 | 3300025981 | Ga0207640_10112138 | Ga0207640_101121382 | 186 |
| 522 | 3300025986 | Ga0207658_10147651 | Ga0207658_101476512 | 186 |
| 523 | 3300025986 | Ga0207658_10187202 | Ga0207658_101872022 | 186 |
| 524 | 3300026023 | Ga0207677_10018312 | Ga0207677_100183121 | 186 |
| 525 | 3300026035 | Ga0207703_10048898 | Ga0207703_100488982 | 186 |
| 526 | 3300026041 | Ga0207639_10206472 | Ga0207639_102064722 | 186 |
| 527 | 3300026067 | Ga0207678_10000328 | Ga0207678_1000032822 | 186 |
| 528 | 3300026088 | Ga0207641_10001283 | Ga0207641_1000128322 | 186 |
| 529 | 3300026089 | Ga0207648_10000826 | Ga0207648_1000082623 | 186 |
| 530 | 3300026095 | Ga0207676_10000058 | Ga0207676_1000005873 | 186 |
| 531 | 3300026116 | Ga0207674_10000148 | Ga0207674_1000014828 | 186 |
| 532 | 3300026116 | Ga0207674_10049534 | Ga0207674_100495342 | 186 |
| 533 | 3300026118 | Ga0207675_100275256 | Ga0207675_1002752562 | 186 |
| 534 | 3300026121 | Ga0207683_10013575 | Ga0207683_100135754 | 186 |
| 535 | 3300028380 | Ga0268265_10026162 | Ga0268265_100261626 | 186 |
| 536 | 3300028381 | Ga0268264_10093906 | Ga0268264_100939063 | 186 |
| 537 | 3300028381 | Ga0268264_10278252 | Ga0268264_102782522 | 186 |
| 538 | 3300030878 | Ga0265770_1002756 | Ga0265770_10027563 | 186 |
| 539 | 3300031090 | Ga0265760_10000172 | Ga0265760_100001725 | 186 |
| 540 | 3300031090 | Ga0265760_10006480 | Ga0265760_100064803 | 186 |
| 541 | 3300031090 | Ga0265760_10071720 | Ga0265760_100717202 | 186 |
| 542 | 3300033547 | Ga0316212_1022695 | Ga0316212_10226952 | 186 |
| 543 | 3300035170 | Ga0373943_0119556 | Ga0373943_0119556_810_1382 | 186 |
| 544 | 3300035724 | Ga0373933_0331108 | Ga0373933_0331108_171_743 | 186 |
| 545 | 3300036401 | Ga0373937_0102846 | Ga0373937_0102846_1741_2304 | 186 |
| 546 | 3300039438 | Ga0436360_0028730 | Ga0436360_0028730_1649_2215 | 186 |
| 547 | 3300039453 | Ga0436362_1017484 | Ga0436362_1017484_47_610 | 186 |
| 548 | 3300046472 | Ga0495580_0047143 | Ga0495580_0047143_675_1247 | 186 |
| 549 | 3300046517 | Ga0495630_0572127 | Ga0495630_0572127_207_782 | 186 |
| 550 | 3300047319 | Ga0495674_0139553 | Ga0495674_0139553_328_900 | 186 |
| 551 | 3300047319 | Ga0495674_0648838 | Ga0495674_0648838_94_666 | 186 |
| 552 | 3300048904 | Ga0496101_0450630 | Ga0496101_0450630_226_789 | 186 |
| 553 | 3300048905 | Ga0496102_0053318 | Ga0496102_0053318_2751_3314 | 186 |
| 554 | 3300048905 | Ga0496102_0396889 | Ga0496102_0396889_70_633 | 186 |
| 555 | 3300048909 | Ga0496106_0359074 | Ga0496106_0359074_551_1114 | 186 |
| 556 | 3300048911 | Ga0496108_0000170 | Ga0496108_0000170_21636_22199 | 186 |
| 557 | 3300048912 | Ga0496109_0000621 | Ga0496109_0000621_4922_5485 | 186 |
| 558 | 3300048913 | Ga0496110_0019980 | Ga0496110_0019980_846_1409 | 186 |
| 559 | 3300048914 | Ga0496111_0371204 | Ga0496111_0371204_232_795 | 186 |
| 560 | 3300048915 | Ga0496112_0000152 | Ga0496112_0000152_36151_36714 | 186 |
| 561 | 3300048915 | Ga0496112_0749567 | Ga0496112_0749567_62_625 | 186 |
| 562 | 3300048916 | Ga0496113_0018313 | Ga0496113_0018313_3907_4470 | 186 |
| 563 | 3300048918 | Ga0496115_0043711 | Ga0496115_0043711_2859_3422 | 186 |
| 564 | 3300050512 | nmdc:mga0n895_1999_c1 | nmdc:mga0n895_1999_c1_7621_8316 | 186 |
| 565 | 3300050515 | nmdc:mga0a205_164152_c1 | nmdc:mga0a205_164152_c1_208_903 | 186 |
| 566 | 3300053078 | Ga0495612_0171175 | Ga0495612_0171175_44_616 | 186 |
| 567 | 2162886012 | MBSR1b_contig_8075501 | MBSR1b_0328.00005470 | 187 |
| 568 | 3300005290 | Ga0065712_10086293 | Ga0065712_100862933 | 187 |
| 569 | 3300005293 | Ga0065715_10236585 | Ga0065715_102365852 | 187 |
| 570 | 3300005329 | Ga0070683_100073917 | Ga0070683_1000739174 | 187 |
| 571 | 3300005330 | Ga0070690_100006782 | Ga0070690_1000067823 | 187 |
| 572 | 3300005331 | Ga0070670_100055647 | Ga0070670_1000556474 | 187 |
| 573 | 3300005334 | Ga0068869_100173917 | Ga0068869_1001739172 | 187 |
| 574 | 3300005335 | Ga0070666_10010790 | Ga0070666_100107904 | 187 |
| 575 | 3300005335 | Ga0070666_10265759 | Ga0070666_102657592 | 187 |
| 576 | 3300005336 | Ga0070680_100235706 | Ga0070680_1002357062 | 187 |
| 577 | 3300005337 | Ga0070682_100012261 | Ga0070682_1000122614 | 187 |
| 578 | 3300005337 | Ga0070682_100060121 | Ga0070682_1000601213 | 187 |
| 579 | 3300005338 | Ga0068868_100040602 | Ga0068868_1000406022 | 187 |
| 580 | 3300005338 | Ga0068868_100272670 | Ga0068868_1002726702 | 187 |
| 581 | 3300005339 | Ga0070660_100015581 | Ga0070660_1000155814 | 187 |
| 582 | 3300005339 | Ga0070660_100068642 | Ga0070660_1000686422 | 187 |
| 583 | 3300005344 | Ga0070661_100022951 | Ga0070661_1000229512 | 187 |
| 584 | 3300005344 | Ga0070661_100282225 | Ga0070661_1002822252 | 187 |
| 585 | 3300005345 | Ga0070692_10061273 | Ga0070692_100612732 | 187 |
| 586 | 3300005347 | Ga0070668_100043770 | Ga0070668_1000437702 | 187 |
| 587 | 3300005353 | Ga0070669_100202873 | Ga0070669_1002028732 | 187 |
| 588 | 3300005355 | Ga0070671_100057674 | Ga0070671_1000576743 | 187 |
| 589 | 3300005366 | Ga0070659_100010808 | Ga0070659_1000108082 | 187 |
| 590 | 3300005366 | Ga0070659_100028466 | Ga0070659_1000284663 | 187 |
| 591 | 3300005367 | Ga0070667_100018917 | Ga0070667_1000189176 | 187 |
| 592 | 3300005367 | Ga0070667_100741985 | Ga0070667_1007419851 | 187 |
| 593 | 3300005367 | Ga0070667_100906509 | Ga0070667_1009065092 | 187 |
| 594 | 3300005434 | Ga0070709_10033980 | Ga0070709_100339802 | 187 |
| 595 | 3300005434 | Ga0070709_10070113 | Ga0070709_100701133 | 187 |
| 596 | 3300005435 | Ga0070714_100003775 | Ga0070714_1000037755 | 187 |
| 597 | 3300005436 | Ga0070713_100009328 | Ga0070713_1000093285 | 187 |
| 598 | 3300005436 | Ga0070713_100074368 | Ga0070713_1000743683 | 187 |
| 599 | 3300005436 | Ga0070713_100192372 | Ga0070713_1001923724 | 187 |
| 600 | 3300005436 | Ga0070713_100245534 | Ga0070713_1002455341 | 187 |
| 601 | 3300005436 | Ga0070713_101290489 | Ga0070713_1012904891 | 187 |
| 602 | 3300005437 | Ga0070710_10029956 | Ga0070710_100299563 | 187 |
| 603 | 3300005439 | Ga0070711_100003297 | Ga0070711_1000032975 | 187 |
| 604 | 3300005439 | Ga0070711_100006867 | Ga0070711_1000068674 | 187 |
| 605 | 3300005439 | Ga0070711_100256528 | Ga0070711_1002565282 | 187 |
| 606 | 3300005439 | Ga0070711_100798451 | Ga0070711_1007984511 | 187 |
| 607 | 3300005445 | Ga0070708_100013578 | Ga0070708_1000135787 | 187 |
| 608 | 3300005445 | Ga0070708_100016686 | Ga0070708_1000166864 | 187 |
| 609 | 3300005445 | Ga0070708_100018605 | Ga0070708_1000186054 | 187 |
| 610 | 3300005445 | Ga0070708_100425606 | Ga0070708_1004256062 | 187 |
| 611 | 3300005445 | Ga0070708_100632224 | Ga0070708_1006322242 | 187 |
| 612 | 3300005455 | Ga0070663_100096309 | Ga0070663_1000963093 | 187 |
| 613 | 3300005456 | Ga0070678_100301407 | Ga0070678_1003014072 | 187 |
| 614 | 3300005456 | Ga0070678_100677526 | Ga0070678_1006775262 | 187 |
| 615 | 3300005457 | Ga0070662_100001509 | Ga0070662_10000150912 | 187 |
| 616 | 3300005458 | Ga0070681_10072813 | Ga0070681_100728131 | 187 |
| 617 | 3300005458 | Ga0070681_10074313 | Ga0070681_100743133 | 187 |
| 618 | 3300005458 | Ga0070681_10101548 | Ga0070681_101015482 | 187 |
| 619 | 3300005459 | Ga0068867_100061067 | Ga0068867_1000610674 | 187 |
| 620 | 3300005466 | Ga0070685_10066079 | Ga0070685_100660792 | 187 |
| 621 | 3300005467 | Ga0070706_100000454 | Ga0070706_10000045432 | 187 |
| 622 | 3300005467 | Ga0070706_100002171 | Ga0070706_10000217115 | 187 |
| 623 | 3300005467 | Ga0070706_100033498 | Ga0070706_1000334983 | 187 |
| 624 | 3300005467 | Ga0070706_100089643 | Ga0070706_1000896433 | 187 |
| 625 | 3300005467 | Ga0070706_100102492 | Ga0070706_1001024923 | 187 |
| 626 | 3300005468 | Ga0070707_100001443 | Ga0070707_1000014434 | 187 |
| 627 | 3300005468 | Ga0070707_100010916 | Ga0070707_1000109166 | 187 |
| 628 | 3300005468 | Ga0070707_100031745 | Ga0070707_1000317454 | 187 |
| 629 | 3300005468 | Ga0070707_101027885 | Ga0070707_1010278851 | 187 |
| 630 | 3300005471 | Ga0070698_100000216 | Ga0070698_10000021632 | 187 |
| 631 | 3300005471 | Ga0070698_100833582 | Ga0070698_1008335822 | 187 |
| 632 | 3300005518 | Ga0070699_100017274 | Ga0070699_1000172745 | 187 |
| 633 | 3300005530 | Ga0070679_100070772 | Ga0070679_1000707722 | 187 |
| 634 | 3300005530 | Ga0070679_100103365 | Ga0070679_1001033652 | 187 |
| 635 | 3300005530 | Ga0070679_100474383 | Ga0070679_1004743832 | 187 |
| 636 | 3300005535 | Ga0070684_100036867 | Ga0070684_1000368672 | 187 |
| 637 | 3300005535 | Ga0070684_100132654 | Ga0070684_1001326542 | 187 |
| 638 | 3300005536 | Ga0070697_100001523 | Ga0070697_10000152311 | 187 |
| 639 | 3300005536 | Ga0070697_100055246 | Ga0070697_1000552462 | 187 |
| 640 | 3300005536 | Ga0070697_100092384 | Ga0070697_1000923842 | 187 |
| 641 | 3300005536 | Ga0070697_100199755 | Ga0070697_1001997551 | 187 |
| 642 | 3300005536 | Ga0070697_100380771 | Ga0070697_1003807711 | 187 |
| 643 | 3300005536 | Ga0070697_100562381 | Ga0070697_1005623811 | 187 |
| 644 | 3300005536 | Ga0070697_100637354 | Ga0070697_1006373541 | 187 |
| 645 | 3300005539 | Ga0068853_100040217 | Ga0068853_1000402174 | 187 |
| 646 | 3300005539 | Ga0068853_100118454 | Ga0068853_1001184542 | 187 |
| 647 | 3300005544 | Ga0070686_100010765 | Ga0070686_1000107654 | 187 |
| 648 | 3300005545 | Ga0070695_100013438 | Ga0070695_1000134383 | 187 |
| 649 | 3300005545 | Ga0070695_100210979 | Ga0070695_1002109792 | 187 |
| 650 | 3300005546 | Ga0070696_100168212 | Ga0070696_1001682122 | 187 |
| 651 | 3300005546 | Ga0070696_100335292 | Ga0070696_1003352921 | 187 |
| 652 | 3300005547 | Ga0070693_100009042 | Ga0070693_1000090422 | 187 |
| 653 | 3300005547 | Ga0070693_100441959 | Ga0070693_1004419592 | 187 |
| 654 | 3300005547 | Ga0070693_100841538 | Ga0070693_1008415381 | 187 |
| 655 | 3300005548 | Ga0070665_100050113 | Ga0070665_1000501135 | 187 |
| 656 | 3300005548 | Ga0070665_100429110 | Ga0070665_1004291101 | 187 |
| 657 | 3300005549 | Ga0070704_100461517 | Ga0070704_1004615172 | 187 |
| 658 | 3300005563 | Ga0068855_100166960 | Ga0068855_1001669604 | 187 |
| 659 | 3300005563 | Ga0068855_100398673 | Ga0068855_1003986732 | 187 |
| 660 | 3300005564 | Ga0070664_100018900 | Ga0070664_1000189004 | 187 |
| 661 | 3300005564 | Ga0070664_100049580 | Ga0070664_1000495802 | 187 |
| 662 | 3300005564 | Ga0070664_100493833 | Ga0070664_1004938332 | 187 |
| 663 | 3300005577 | Ga0068857_100056730 | Ga0068857_1000567302 | 187 |
| 664 | 3300005577 | Ga0068857_100202557 | Ga0068857_1002025572 | 187 |
| 665 | 3300005578 | Ga0068854_100161548 | Ga0068854_1001615481 | 187 |
| 666 | 3300005614 | Ga0068856_100048394 | Ga0068856_1000483943 | 187 |
| 667 | 3300005614 | Ga0068856_100106639 | Ga0068856_1001066393 | 187 |
| 668 | 3300005614 | Ga0068856_100307703 | Ga0068856_1003077032 | 187 |
| 669 | 3300005616 | Ga0068852_100180529 | Ga0068852_1001805292 | 187 |
| 670 | 3300005616 | Ga0068852_100319699 | Ga0068852_1003196993 | 187 |
| 671 | 3300005617 | Ga0068859_100015249 | Ga0068859_1000152494 | 187 |
| 672 | 3300005618 | Ga0068864_100271583 | Ga0068864_1002715832 | 187 |
| 673 | 3300005718 | Ga0068866_10021658 | Ga0068866_100216583 | 187 |
| 674 | 3300005834 | Ga0068851_10007945 | Ga0068851_100079453 | 187 |
| 675 | 3300005841 | Ga0068863_100056594 | Ga0068863_1000565943 | 187 |
| 676 | 3300005841 | Ga0068863_100058737 | Ga0068863_1000587373 | 187 |
| 677 | 3300005842 | Ga0068858_100026465 | Ga0068858_1000264654 | 187 |
| 678 | 3300005842 | Ga0068858_100233188 | Ga0068858_1002331882 | 187 |
| 679 | 3300005843 | Ga0068860_100060161 | Ga0068860_1000601612 | 187 |
| 680 | 3300005844 | Ga0068862_100215943 | Ga0068862_1002159432 | 187 |
| 681 | 3300006028 | Ga0070717_10019684 | Ga0070717_100196843 | 187 |
| 682 | 3300006028 | Ga0070717_10039792 | Ga0070717_100397923 | 187 |
| 683 | 3300006028 | Ga0070717_10329442 | Ga0070717_103294421 | 187 |
| 684 | 3300006028 | Ga0070717_10406145 | Ga0070717_104061452 | 187 |
| 685 | 3300006028 | Ga0070717_10974984 | Ga0070717_109749842 | 187 |
| 686 | 3300006163 | Ga0070715_10020920 | Ga0070715_100209202 | 187 |
| 687 | 3300006163 | Ga0070715_10033486 | Ga0070715_100334863 | 187 |
| 688 | 3300006163 | Ga0070715_10054611 | Ga0070715_100546112 | 187 |
| 689 | 3300006173 | Ga0070716_100000426 | Ga0070716_10000042617 | 187 |
| 690 | 3300006173 | Ga0070716_100031549 | Ga0070716_1000315492 | 187 |
| 691 | 3300006173 | Ga0070716_100035419 | Ga0070716_1000354192 | 187 |
| 692 | 3300006173 | Ga0070716_100039461 | Ga0070716_1000394613 | 187 |
| 693 | 3300006173 | Ga0070716_100042771 | Ga0070716_1000427712 | 187 |
| 694 | 3300006173 | Ga0070716_100341712 | Ga0070716_1003417122 | 187 |
| 695 | 3300006175 | Ga0070712_100000375 | Ga0070712_1000003753 | 187 |
| 696 | 3300006175 | Ga0070712_100000952 | Ga0070712_10000095210 | 187 |
| 697 | 3300006175 | Ga0070712_100153506 | Ga0070712_1001535063 | 187 |
| 698 | 3300006175 | Ga0070712_100884971 | Ga0070712_1008849711 | 187 |
| 699 | 3300006237 | Ga0097621_100138738 | Ga0097621_1001387382 | 187 |
| 700 | 3300006237 | Ga0097621_100292498 | Ga0097621_1002924981 | 187 |
| 701 | 3300006358 | Ga0068871_100025052 | Ga0068871_1000250525 | 187 |
| 702 | 3300006358 | Ga0068871_100125464 | Ga0068871_1001254642 | 187 |
| 703 | 3300006358 | Ga0068871_100254468 | Ga0068871_1002544682 | 187 |
| 704 | 3300006852 | Ga0075433_10020011 | Ga0075433_100200116 | 187 |
| 705 | 3300006871 | Ga0075434_100000460 | Ga0075434_10000046027 | 187 |
| 706 | 3300006871 | Ga0075434_100039922 | Ga0075434_1000399223 | 187 |
| 707 | 3300006881 | Ga0068865_100134911 | Ga0068865_1001349112 | 187 |
| 708 | 3300006881 | Ga0068865_100527383 | Ga0068865_1005273832 | 187 |
| 709 | 3300006914 | Ga0075436_100010225 | Ga0075436_1000102253 | 187 |
| 710 | 3300006914 | Ga0075436_100164013 | Ga0075436_1001640132 | 187 |
| 711 | 3300006931 | Ga0097620_100015248 | Ga0097620_1000152484 | 187 |
| 712 | 3300007076 | Ga0075435_100000141 | Ga0075435_10000014131 | 187 |
| 713 | 3300009093 | Ga0105240_10023147 | Ga0105240_100231473 | 187 |
| 714 | 3300009093 | Ga0105240_10088126 | Ga0105240_100881263 | 187 |
| 715 | 3300009093 | Ga0105240_10287080 | Ga0105240_102870802 | 187 |
| 716 | 3300009093 | Ga0105240_10331301 | Ga0105240_103313012 | 187 |
| 717 | 3300009098 | Ga0105245_10070411 | Ga0105245_100704113 | 187 |
| 718 | 3300009101 | Ga0105247_10025257 | Ga0105247_100252573 | 187 |
| 719 | 3300009101 | Ga0105247_10038216 | Ga0105247_100382163 | 187 |
| 720 | 3300009148 | Ga0105243_10858585 | Ga0105243_108585851 | 187 |
| 721 | 3300009174 | Ga0105241_10026676 | Ga0105241_100266763 | 187 |
| 722 | 3300009174 | Ga0105241_10050807 | Ga0105241_100508074 | 187 |
| 723 | 3300009174 | Ga0105241_10085581 | Ga0105241_100855812 | 187 |
| 724 | 3300009174 | Ga0105241_10218798 | Ga0105241_102187982 | 187 |
| 725 | 3300009174 | Ga0105241_10258244 | Ga0105241_102582441 | 187 |
| 726 | 3300009176 | Ga0105242_10045283 | Ga0105242_100452831 | 187 |
| 727 | 3300009176 | Ga0105242_10081210 | Ga0105242_100812102 | 187 |
| 728 | 3300009177 | Ga0105248_10111178 | Ga0105248_101111782 | 187 |
| 729 | 3300009177 | Ga0105248_10119859 | Ga0105248_101198591 | 187 |
| 730 | 3300009177 | Ga0105248_10734650 | Ga0105248_107346502 | 187 |
| 731 | 3300009545 | Ga0105237_10021829 | Ga0105237_100218293 | 187 |
| 732 | 3300009545 | Ga0105237_10299535 | Ga0105237_102995351 | 187 |
| 733 | 3300009551 | Ga0105238_10023454 | Ga0105238_100234543 | 187 |
| 734 | 3300009551 | Ga0105238_10037684 | Ga0105238_100376843 | 187 |
| 735 | 3300009551 | Ga0105238_10055918 | Ga0105238_100559182 | 187 |
| 736 | 3300009553 | Ga0105249_10025448 | Ga0105249_100254483 | 187 |
| 737 | 3300009553 | Ga0105249_10961789 | Ga0105249_109617892 | 187 |
| 738 | 3300010375 | Ga0105239_10373781 | Ga0105239_103737812 | 187 |
| 739 | 3300011119 | Ga0105246_10065236 | Ga0105246_100652362 | 187 |
| 740 | 3300013100 | Ga0157373_10032458 | Ga0157373_100324582 | 187 |
| 741 | 3300013100 | Ga0157373_10130589 | Ga0157373_101305891 | 187 |
| 742 | 3300013100 | Ga0157373_10189097 | Ga0157373_101890972 | 187 |
| 743 | 3300013102 | Ga0157371_10010976 | Ga0157371_100109763 | 187 |
| 744 | 3300013105 | Ga0157369_10250963 | Ga0157369_102509632 | 187 |
| 745 | 3300013296 | Ga0157374_10022134 | Ga0157374_100221344 | 187 |
| 746 | 3300013296 | Ga0157374_10072470 | Ga0157374_100724703 | 187 |
| 747 | 3300013296 | Ga0157374_10531583 | Ga0157374_105315832 | 187 |
| 748 | 3300013297 | Ga0157378_10053001 | Ga0157378_100530012 | 187 |
| 749 | 3300013297 | Ga0157378_10169006 | Ga0157378_101690061 | 187 |
| 750 | 3300013297 | Ga0157378_10567007 | Ga0157378_105670072 | 187 |
| 751 | 3300013297 | Ga0157378_10859808 | Ga0157378_108598081 | 187 |
| 752 | 3300013297 | Ga0157378_11095831 | Ga0157378_110958311 | 187 |
| 753 | 3300013306 | Ga0163162_10001366 | Ga0163162_100013666 | 187 |
| 754 | 3300013306 | Ga0163162_10004521 | Ga0163162_100045214 | 187 |
| 755 | 3300013306 | Ga0163162_10425830 | Ga0163162_104258301 | 187 |
| 756 | 3300013307 | Ga0157372_10148560 | Ga0157372_101485603 | 187 |
| 757 | 3300013308 | Ga0157375_10039878 | Ga0157375_100398783 | 187 |
| 758 | 3300014325 | Ga0163163_10191042 | Ga0163163_101910422 | 187 |
| 759 | 3300014325 | Ga0163163_10607816 | Ga0163163_106078162 | 187 |
| 760 | 3300014497 | Ga0182008_10008926 | Ga0182008_100089266 | 187 |
| 761 | 3300014497 | Ga0182008_10075420 | Ga0182008_100754202 | 187 |
| 762 | 3300014968 | Ga0157379_10017268 | Ga0157379_100172686 | 187 |
| 763 | 3300014968 | Ga0157379_10033479 | Ga0157379_100334793 | 187 |
| 764 | 3300014968 | Ga0157379_10088166 | Ga0157379_100881661 | 187 |
| 765 | 3300014969 | Ga0157376_10031533 | Ga0157376_100315332 | 187 |
| 766 | 3300014969 | Ga0157376_10049823 | Ga0157376_100498231 | 187 |
| 767 | 3300014969 | Ga0157376_10096542 | Ga0157376_100965423 | 187 |
| 768 | 3300014969 | Ga0157376_10127883 | Ga0157376_101278832 | 187 |
| 769 | 3300015261 | Ga0182006_1109024 | Ga0182006_11090241 | 187 |
| 770 | 3300015262 | Ga0182007_10034176 | Ga0182007_100341762 | 187 |
| 771 | 3300015262 | Ga0182007_10053490 | Ga0182007_100534902 | 187 |
| 772 | 3300020080 | Ga0206350_10675980 | Ga0206350_106759802 | 187 |
| 773 | 3300022467 | Ga0224712_10237503 | Ga0224712_102375031 | 187 |
| 774 | 3300022730 | Ga0224570_101218 | Ga0224570_1012183 | 187 |
| 775 | 3300022732 | Ga0224569_103894 | Ga0224569_1038942 | 187 |
| 776 | 3300024225 | Ga0224572_1019941 | Ga0224572_10199412 | 187 |
| 777 | 3300024227 | Ga0228598_1001017 | Ga0228598_10010177 | 187 |
| 778 | 3300025321 | Ga0207656_10008807 | Ga0207656_100088073 | 187 |
| 779 | 3300025898 | Ga0207692_10018782 | Ga0207692_100187823 | 187 |
| 780 | 3300025898 | Ga0207692_10067239 | Ga0207692_100672392 | 187 |
| 781 | 3300025899 | Ga0207642_10269048 | Ga0207642_102690481 | 187 |
| 782 | 3300025900 | Ga0207710_10034258 | Ga0207710_100342583 | 187 |
| 783 | 3300025900 | Ga0207710_10038745 | Ga0207710_100387453 | 187 |
| 784 | 3300025903 | Ga0207680_10113856 | Ga0207680_101138562 | 187 |
| 785 | 3300025905 | Ga0207685_10018401 | Ga0207685_100184014 | 187 |
| 786 | 3300025905 | Ga0207685_10177591 | Ga0207685_101775912 | 187 |
| 787 | 3300025906 | Ga0207699_10005111 | Ga0207699_100051116 | 187 |
| 788 | 3300025906 | Ga0207699_10182271 | Ga0207699_101822711 | 187 |
| 789 | 3300025906 | Ga0207699_10240810 | Ga0207699_102408101 | 187 |
| 790 | 3300025907 | Ga0207645_10037470 | Ga0207645_100374703 | 187 |
| 791 | 3300025910 | Ga0207684_10002803 | Ga0207684_100028039 | 187 |
| 792 | 3300025910 | Ga0207684_10003642 | Ga0207684_100036422 | 187 |
| 793 | 3300025910 | Ga0207684_10066315 | Ga0207684_100663153 | 187 |
| 794 | 3300025910 | Ga0207684_10128330 | Ga0207684_101283302 | 187 |
| 795 | 3300025910 | Ga0207684_10213260 | Ga0207684_102132601 | 187 |
| 796 | 3300025911 | Ga0207654_10046310 | Ga0207654_100463102 | 187 |
| 797 | 3300025911 | Ga0207654_10049753 | Ga0207654_100497532 | 187 |
| 798 | 3300025911 | Ga0207654_10198775 | Ga0207654_101987752 | 187 |
| 799 | 3300025912 | Ga0207707_10003464 | Ga0207707_1000346413 | 187 |
| 800 | 3300025912 | Ga0207707_10034361 | Ga0207707_100343615 | 187 |
| 801 | 3300025913 | Ga0207695_10071973 | Ga0207695_100719734 | 187 |
| 802 | 3300025914 | Ga0207671_10020926 | Ga0207671_100209264 | 187 |
| 803 | 3300025914 | Ga0207671_10158462 | Ga0207671_101584622 | 187 |
| 804 | 3300025915 | Ga0207693_10000214 | Ga0207693_1000021426 | 187 |
| 805 | 3300025915 | Ga0207693_10001731 | Ga0207693_100017318 | 187 |
| 806 | 3300025915 | Ga0207693_10045616 | Ga0207693_100456161 | 187 |
| 807 | 3300025915 | Ga0207693_10195472 | Ga0207693_101954722 | 187 |
| 808 | 3300025915 | Ga0207693_10238573 | Ga0207693_102385732 | 187 |
| 809 | 3300025916 | Ga0207663_10007091 | Ga0207663_100070915 | 187 |
| 810 | 3300025916 | Ga0207663_10008315 | Ga0207663_100083155 | 187 |
| 811 | 3300025916 | Ga0207663_10024149 | Ga0207663_100241494 | 187 |
| 812 | 3300025916 | Ga0207663_10077451 | Ga0207663_100774512 | 187 |
| 813 | 3300025916 | Ga0207663_10185342 | Ga0207663_101853422 | 187 |
| 814 | 3300025916 | Ga0207663_10617102 | Ga0207663_106171021 | 187 |
| 815 | 3300025917 | Ga0207660_10336398 | Ga0207660_103363981 | 187 |
| 816 | 3300025917 | Ga0207660_10386048 | Ga0207660_103860482 | 187 |
| 817 | 3300025919 | Ga0207657_10002947 | Ga0207657_1000294711 | 187 |
| 818 | 3300025919 | Ga0207657_10004279 | Ga0207657_100042797 | 187 |
| 819 | 3300025920 | Ga0207649_10037225 | Ga0207649_100372252 | 187 |
| 820 | 3300025920 | Ga0207649_10043965 | Ga0207649_100439653 | 187 |
| 821 | 3300025921 | Ga0207652_10292653 | Ga0207652_102926532 | 187 |
| 822 | 3300025921 | Ga0207652_10346332 | Ga0207652_103463322 | 187 |
| 823 | 3300025921 | Ga0207652_10887227 | Ga0207652_108872271 | 187 |
| 824 | 3300025922 | Ga0207646_10001233 | Ga0207646_1000123320 | 187 |
| 825 | 3300025922 | Ga0207646_10006853 | Ga0207646_100068536 | 187 |
| 826 | 3300025922 | Ga0207646_10283858 | Ga0207646_102838582 | 187 |
| 827 | 3300025922 | Ga0207646_10424835 | Ga0207646_104248352 | 187 |
| 828 | 3300025922 | Ga0207646_10479440 | Ga0207646_104794401 | 187 |
| 829 | 3300025922 | Ga0207646_11186073 | Ga0207646_111860731 | 187 |
| 830 | 3300025922 | Ga0207646_11394985 | Ga0207646_113949851 | 187 |
| 831 | 3300025924 | Ga0207694_10031776 | Ga0207694_100317764 | 187 |
| 832 | 3300025924 | Ga0207694_10065067 | Ga0207694_100650673 | 187 |
| 833 | 3300025928 | Ga0207700_10003049 | Ga0207700_100030498 | 187 |
| 834 | 3300025928 | Ga0207700_10022345 | Ga0207700_100223454 | 187 |
| 835 | 3300025928 | Ga0207700_10122746 | Ga0207700_101227462 | 187 |
| 836 | 3300025928 | Ga0207700_10187467 | Ga0207700_101874672 | 187 |
| 837 | 3300025928 | Ga0207700_10356448 | Ga0207700_103564482 | 187 |
| 838 | 3300025928 | Ga0207700_10478464 | Ga0207700_104784642 | 187 |
| 839 | 3300025929 | Ga0207664_10000607 | Ga0207664_100006078 | 187 |
| 840 | 3300025929 | Ga0207664_10003402 | Ga0207664_100034022 | 187 |
| 841 | 3300025929 | Ga0207664_10065055 | Ga0207664_100650553 | 187 |
| 842 | 3300025929 | Ga0207664_10235165 | Ga0207664_102351652 | 187 |
| 843 | 3300025931 | Ga0207644_10040273 | Ga0207644_100402732 | 187 |
| 844 | 3300025931 | Ga0207644_10637881 | Ga0207644_106378811 | 187 |
| 845 | 3300025932 | Ga0207690_10053600 | Ga0207690_100536003 | 187 |
| 846 | 3300025932 | Ga0207690_10078606 | Ga0207690_100786063 | 187 |
| 847 | 3300025933 | Ga0207706_10000868 | Ga0207706_1000086814 | 187 |
| 848 | 3300025933 | Ga0207706_10014363 | Ga0207706_100143633 | 187 |
| 849 | 3300025938 | Ga0207704_10021498 | Ga0207704_100214984 | 187 |
| 850 | 3300025938 | Ga0207704_10631510 | Ga0207704_106315101 | 187 |
| 851 | 3300025939 | Ga0207665_10000329 | Ga0207665_1000032928 | 187 |
| 852 | 3300025939 | Ga0207665_10037027 | Ga0207665_100370275 | 187 |
| 853 | 3300025939 | Ga0207665_10041249 | Ga0207665_100412492 | 187 |
| 854 | 3300025939 | Ga0207665_10106501 | Ga0207665_101065013 | 187 |
| 855 | 3300025939 | Ga0207665_10140359 | Ga0207665_101403592 | 187 |
| 856 | 3300025939 | Ga0207665_10212331 | Ga0207665_102123312 | 187 |
| 857 | 3300025939 | Ga0207665_10472234 | Ga0207665_104722341 | 187 |
| 858 | 3300025941 | Ga0207711_10004875 | Ga0207711_100048754 | 187 |
| 859 | 3300025941 | Ga0207711_10403708 | Ga0207711_104037082 | 187 |
| 860 | 3300025942 | Ga0207689_10031999 | Ga0207689_100319995 | 187 |
| 861 | 3300025945 | Ga0207679_10013182 | Ga0207679_100131823 | 187 |
| 862 | 3300025945 | Ga0207679_10238884 | Ga0207679_102388842 | 187 |
| 863 | 3300025961 | Ga0207712_10032280 | Ga0207712_100322804 | 187 |
| 864 | 3300025972 | Ga0207668_10018828 | Ga0207668_100188285 | 187 |
| 865 | 3300025981 | Ga0207640_10189376 | Ga0207640_101893762 | 187 |
| 866 | 3300025986 | Ga0207658_10714698 | Ga0207658_107146981 | 187 |
| 867 | 3300026023 | Ga0207677_10029386 | Ga0207677_100293862 | 187 |
| 868 | 3300026067 | Ga0207678_10002447 | Ga0207678_100024475 | 187 |
| 869 | 3300026067 | Ga0207678_10124199 | Ga0207678_101241993 | 187 |
| 870 | 3300026078 | Ga0207702_10020286 | Ga0207702_100202863 | 187 |
| 871 | 3300026078 | Ga0207702_10432549 | Ga0207702_104325492 | 187 |
| 872 | 3300026078 | Ga0207702_10602011 | Ga0207702_106020112 | 187 |
| 873 | 3300026088 | Ga0207641_10296256 | Ga0207641_102962562 | 187 |
| 874 | 3300026088 | Ga0207641_10923134 | Ga0207641_109231341 | 187 |
| 875 | 3300026089 | Ga0207648_10066105 | Ga0207648_100661053 | 187 |
| 876 | 3300026089 | Ga0207648_10755061 | Ga0207648_107550611 | 187 |
| 877 | 3300026116 | Ga0207674_10058791 | Ga0207674_100587912 | 187 |
| 878 | 3300026116 | Ga0207674_10186877 | Ga0207674_101868772 | 187 |
| 879 | 3300026121 | Ga0207683_10153126 | Ga0207683_101531263 | 187 |
| 880 | 3300026142 | Ga0207698_10131924 | Ga0207698_101319242 | 187 |
| 881 | 3300027671 | Ga0209588_1140410 | Ga0209588_11404101 | 187 |
| 882 | 3300028017 | Ga0265356_1000040 | Ga0265356_100004025 | 187 |
| 883 | 3300028379 | Ga0268266_10074822 | Ga0268266_100748222 | 187 |
| 884 | 3300028379 | Ga0268266_10396620 | Ga0268266_103966201 | 187 |
| 885 | 3300028380 | Ga0268265_10212363 | Ga0268265_102123631 | 187 |
| 886 | 3300028381 | Ga0268264_10175561 | Ga0268264_101755612 | 187 |
| 887 | 3300028800 | Ga0265338_10008016 | Ga0265338_100080165 | 187 |
| 888 | 3300028800 | Ga0265338_10099047 | Ga0265338_100990472 | 187 |
| 889 | 3300030760 | Ga0265762_1002743 | Ga0265762_10027432 | 187 |
| 890 | 3300030760 | Ga0265762_1012728 | Ga0265762_10127281 | 187 |
| 891 | 3300031090 | Ga0265760_10008939 | Ga0265760_100089392 | 187 |
| 892 | 3300031241 | Ga0265325_10021987 | Ga0265325_100219872 | 187 |
| 893 | 3300031241 | Ga0265325_10072187 | Ga0265325_100721872 | 187 |
| 894 | 3300031344 | Ga0265316_10197606 | Ga0265316_101976062 | 187 |
| 895 | 3300031711 | Ga0265314_10002967 | Ga0265314_1000296717 | 187 |
| 896 | 3300031711 | Ga0265314_10022093 | Ga0265314_100220932 | 187 |
| 897 | 3300033545 | Ga0316214_1025086 | Ga0316214_10250862 | 187 |
| 898 | 3300034817 | Ga0373948_0024983 | Ga0373948_0024983_206_772 | 187 |
| 899 | 3300035086 | Ga0373934_0035489 | Ga0373934_0035489_869_1444 | 187 |
| 900 | 3300035088 | Ga0373940_0170900 | Ga0373940_0170900_91_657 | 187 |
| 901 | 3300035089 | Ga0373944_0075397 | Ga0373944_0075397_54_629 | 187 |
| 902 | 3300035112 | Ga0373932_0039896 | Ga0373932_0039896_249_815 | 187 |
| 903 | 3300035113 | Ga0373936_0068571 | Ga0373936_0068571_305_880 | 187 |
| 904 | 3300035113 | Ga0373936_0084815 | Ga0373936_0084815_641_1216 | 187 |
| 905 | 3300035115 | Ga0373941_0165355 | Ga0373941_0165355_92_661 | 187 |
| 906 | 3300035116 | Ga0373945_0011201 | Ga0373945_0011201_223_798 | 187 |
| 907 | 3300035116 | Ga0373945_0149661 | Ga0373945_0149661_94_669 | 187 |
| 908 | 3300035117 | Ga0373953_0018713 | Ga0373953_0018713_1005_1580 | 187 |
| 909 | 3300035118 | Ga0373954_0038167 | Ga0373954_0038167_1065_1640 | 187 |
| 910 | 3300035120 | Ga0373957_0063596 | Ga0373957_0063596_715_1290 | 187 |
| 911 | 3300035170 | Ga0373943_0003361 | Ga0373943_0003361_5849_6424 | 187 |
| 912 | 3300035171 | Ga0373946_0115928 | Ga0373946_0115928_41_616 | 187 |
| 913 | 3300035172 | Ga0373955_0044316 | Ga0373955_0044316_532_1107 | 187 |
| 914 | 3300035172 | Ga0373955_0179627 | Ga0373955_0179627_660_1235 | 187 |
| 915 | 3300035410 | Ga0373924_0008187 | Ga0373924_0008187_2089_2664 | 187 |
| 916 | 3300035692 | Ga0373935_0010998 | Ga0373935_0010998_504_1079 | 187 |
| 917 | 3300035692 | Ga0373935_0024085 | Ga0373935_0024085_1462_2037 | 187 |
| 918 | 3300035695 | Ga0373927_0000097 | Ga0373927_0000097_36755_37330 | 187 |
| 919 | 3300035695 | Ga0373927_0101974 | Ga0373927_0101974_41_616 | 187 |
| 920 | 3300035695 | Ga0373927_0235915 | Ga0373927_0235915_587_1153 | 187 |
| 921 | 3300035724 | Ga0373933_0008807 | Ga0373933_0008807_733_1308 | 187 |
| 922 | 3300035724 | Ga0373933_0175895 | Ga0373933_0175895_260_835 | 187 |
| 923 | 3300035724 | Ga0373933_0517863 | Ga0373933_0517863_128_703 | 187 |
| 924 | 3300035725 | Ga0373947_0000273 | Ga0373947_0000273_9589_10164 | 187 |
| 925 | 3300035725 | Ga0373947_0103524 | Ga0373947_0103524_614_1189 | 187 |
| 926 | 3300036401 | Ga0373937_0023853 | Ga0373937_0023853_110_685 | 187 |
| 927 | 3300036401 | Ga0373937_0057487 | Ga0373937_0057487_837_1412 | 187 |
| 928 | 3300036401 | Ga0373937_0430781 | Ga0373937_0430781_164_739 | 187 |
| 929 | 3300036401 | Ga0373937_0519497 | Ga0373937_0519497_350_916 | 187 |
| 930 | 3300037068 | Ga0373925_0007055 | Ga0373925_0007055_5537_6112 | 187 |
| 931 | 3300037068 | Ga0373925_0168463 | Ga0373925_0168463_1008_1574 | 187 |
| 932 | 3300044706 | Ga0466964_0350797 | Ga0466964_0350797_158_733 | 187 |
| 933 | 3300044712 | Ga0453684_0312454 | Ga0453684_0312454_67_630 | 187 |
| 934 | 3300045051 | Ga0451576_0613687 | Ga0451576_0613687_91_657 | 187 |
| 935 | 3300045976 | Ga0466967_0446093 | Ga0466967_0446093_408_983 | 187 |
| 936 | 3300046459 | Ga0495629_0062294 | Ga0495629_0062294_1780_2355 | 187 |
| 937 | 3300046472 | Ga0495580_0000390 | Ga0495580_0000390_16171_16746 | 187 |
| 938 | 3300046472 | Ga0495580_0000632 | Ga0495580_0000632_16896_17465 | 187 |
| 939 | 3300046472 | Ga0495580_0003018 | Ga0495580_0003018_8069_8635 | 187 |
| 940 | 3300046472 | Ga0495580_0038873 | Ga0495580_0038873_468_1037 | 187 |
| 941 | 3300046472 | Ga0495580_0182290 | Ga0495580_0182290_348_917 | 187 |
| 942 | 3300046472 | Ga0495580_0182775 | Ga0495580_0182775_387_962 | 187 |
| 943 | 3300046472 | Ga0495580_0292271 | Ga0495580_0292271_247_813 | 187 |
| 944 | 3300046473 | Ga0495582_0116590 | Ga0495582_0116590_437_1012 | 187 |
| 945 | 3300046476 | Ga0495662_0178004 | Ga0495662_0178004_116_691 | 187 |
| 946 | 3300046477 | Ga0495664_0042440 | Ga0495664_0042440_1882_2457 | 187 |
| 947 | 3300046516 | Ga0495628_0170727 | Ga0495628_0170727_184_759 | 187 |
| 948 | 3300046516 | Ga0495628_0251890 | Ga0495628_0251890_442_1017 | 187 |
| 949 | 3300046517 | Ga0495630_0032613 | Ga0495630_0032613_2270_2845 | 187 |
| 950 | 3300046517 | Ga0495630_0773224 | Ga0495630_0773224_128_703 | 187 |
| 951 | 3300046529 | Ga0495652_0183427 | Ga0495652_0183427_32_607 | 187 |
| 952 | 3300046543 | Ga0495645_0063479 | Ga0495645_0063479_1877_2452 | 187 |
| 953 | 3300046642 | Ga0495634_0448689 | Ga0495634_0448689_98_673 | 187 |
| 954 | 3300046664 | Ga0495659_0134217 | Ga0495659_0134217_134_703 | 187 |
| 955 | 3300046678 | Ga0495599_0206136 | Ga0495599_0206136_64_639 | 187 |
| 956 | 3300046683 | Ga0495658_0008453 | Ga0495658_0008453_2806_3381 | 187 |
| 957 | 3300046689 | Ga0495613_0262864 | Ga0495613_0262864_547_1122 | 187 |
| 958 | 3300047319 | Ga0495674_0016019 | Ga0495674_0016019_2694_3269 | 187 |
| 959 | 3300047319 | Ga0495674_0337862 | Ga0495674_0337862_531_1106 | 187 |
| 960 | 3300047321 | Ga0495676_0198784 | Ga0495676_0198784_677_1252 | 187 |
| 961 | 3300047321 | Ga0495676_0426488 | Ga0495676_0426488_204_770 | 187 |
| 962 | 3300048088 | Ga0495602_0095210 | Ga0495602_0095210_1270_1845 | 187 |
| 963 | 3300048903 | Ga0496100_0119274 | Ga0496100_0119274_48_614 | 187 |
| 964 | 3300048903 | Ga0496100_0233714 | Ga0496100_0233714_380_955 | 187 |
| 965 | 3300048903 | Ga0496100_0344815 | Ga0496100_0344815_493_1059 | 187 |
| 966 | 3300048904 | Ga0496101_0038805 | Ga0496101_0038805_585_1148 | 187 |
| 967 | 3300048904 | Ga0496101_0117394 | Ga0496101_0117394_477_1052 | 187 |
| 968 | 3300048904 | Ga0496101_0309521 | Ga0496101_0309521_454_1020 | 187 |
| 969 | 3300048905 | Ga0496102_0010132 | Ga0496102_0010132_4518_5084 | 187 |
| 970 | 3300048905 | Ga0496102_0046899 | Ga0496102_0046899_2128_2694 | 187 |
| 971 | 3300048905 | Ga0496102_0194099 | Ga0496102_0194099_779_1345 | 187 |
| 972 | 3300048906 | Ga0496103_0003667 | Ga0496103_0003667_7780_8346 | 187 |
| 973 | 3300048906 | Ga0496103_0114317 | Ga0496103_0114317_934_1497 | 187 |
| 974 | 3300048907 | Ga0496104_0064252 | Ga0496104_0064252_564_1130 | 187 |
| 975 | 3300048907 | Ga0496104_0093388 | Ga0496104_0093388_284_847 | 187 |
| 976 | 3300048907 | Ga0496104_0148251 | Ga0496104_0148251_135_701 | 187 |
| 977 | 3300048907 | Ga0496104_0230735 | Ga0496104_0230735_487_1062 | 187 |
| 978 | 3300048907 | Ga0496104_0572586 | Ga0496104_0572586_406_972 | 187 |
| 979 | 3300048908 | Ga0496105_0219216 | Ga0496105_0219216_534_1100 | 187 |
| 980 | 3300048908 | Ga0496105_0265041 | Ga0496105_0265041_401_964 | 187 |
| 981 | 3300048909 | Ga0496106_0031873 | Ga0496106_0031873_2773_3339 | 187 |
| 982 | 3300048909 | Ga0496106_0089262 | Ga0496106_0089262_1404_1970 | 187 |
| 983 | 3300048909 | Ga0496106_0104752 | Ga0496106_0104752_53_619 | 187 |
| 984 | 3300048909 | Ga0496106_0372534 | Ga0496106_0372534_347_910 | 187 |
| 985 | 3300048910 | Ga0496107_0025905 | Ga0496107_0025905_473_1039 | 187 |
| 986 | 3300048910 | Ga0496107_0108449 | Ga0496107_0108449_519_1085 | 187 |
| 987 | 3300048911 | Ga0496108_0039842 | Ga0496108_0039842_573_1136 | 187 |
| 988 | 3300048911 | Ga0496108_0284098 | Ga0496108_0284098_135_701 | 187 |
| 989 | 3300048911 | Ga0496108_0346063 | Ga0496108_0346063_524_1090 | 187 |
| 990 | 3300048911 | Ga0496108_0412356 | Ga0496108_0412356_213_779 | 187 |
| 991 | 3300048912 | Ga0496109_0055729 | Ga0496109_0055729_369_932 | 187 |
| 992 | 3300048912 | Ga0496109_0522454 | Ga0496109_0522454_493_1059 | 187 |
| 993 | 3300048913 | Ga0496110_0392830 | Ga0496110_0392830_192_755 | 187 |
| 994 | 3300048914 | Ga0496111_0002648 | Ga0496111_0002648_2778_3341 | 187 |
| 995 | 3300048915 | Ga0496112_0534070 | Ga0496112_0534070_190_756 | 187 |
| 996 | 3300048915 | Ga0496112_0885368 | Ga0496112_0885368_154_720 | 187 |
| 997 | 3300048916 | Ga0496113_0053888 | Ga0496113_0053888_83_646 | 187 |
| 998 | 3300048917 | Ga0496114_0024403 | Ga0496114_0024403_2670_3236 | 187 |
| 999 | 3300048917 | Ga0496114_0056277 | Ga0496114_0056277_1236_1811 | 187 |
| 1000 | 3300048918 | Ga0496115_0012647 | Ga0496115_0012647_130_705 | 187 |
| 1001 | 3300048918 | Ga0496115_0224682 | Ga0496115_0224682_620_1195 | 187 |
| 1002 | 3300048918 | Ga0496115_0344194 | Ga0496115_0344194_238_804 | 187 |
| 1003 | 3300049589 | Ga0501073_0514696 | Ga0501073_0514696_36_605 | 187 |
| 1004 | 3300049744 | Ga0501083_0285583 | Ga0501083_0285583_320_889 | 187 |
| 1005 | 3300050512 | nmdc:mga0n895_1163_c1 | nmdc:mga0n895_1163_c1_17420_17986 | 187 |
| 1006 | 3300050512 | nmdc:mga0n895_404245_c1 | nmdc:mga0n895_404245_c1_341_907 | 187 |
| 1007 | 3300050513 | nmdc:mga0rr50_457197_c1 | nmdc:mga0rr50_457197_c1_461_1027 | 187 |
| 1008 | 3300050514 | nmdc:mga08x19_103183_c1 | nmdc:mga08x19_103183_c1_741_1307 | 187 |
| 1009 | 3300050514 | nmdc:mga08x19_3802_c1 | nmdc:mga08x19_3802_c1_2465_3031 | 187 |
| 1010 | 3300050515 | nmdc:mga0a205_25343_c1 | nmdc:mga0a205_25343_c1_1378_1944 | 187 |
| 1011 | 3300053077 | Ga0495601_0057857 | Ga0495601_0057857_1395_1970 | 187 |
| 1012 | 3300053078 | Ga0495612_0098517 | Ga0495612_0098517_342_908 | 187 |
| 1013 | 3300053078 | Ga0495612_0250525 | Ga0495612_0250525_157_732 | 187 |
| 1014 | 3300053085 | Ga0495619_0190933 | Ga0495619_0190933_748_1323 | 187 |
| 1015 | 3300053085 | Ga0495619_0300298 | Ga0495619_0300298_145_711 | 187 |
| 1016 | 3300054114 | Ga0501084_0399363 | Ga0501084_0399363_52_621 | 187 |
| 1017 | 3300059490 | Ga0587066_010893 | Ga0587066_010893_597_1160 | 187 |
| 1018 | 3300059505 | Ga0587083_0014262 | Ga0587083_0014262_191_754 | 187 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2vkj-assembly1.cif.gz_A | structure of the soluble domain of the membrane protein tm1634 from thermotoga maritima | 0.9658 | 16 | 67 |
| 2avp-assembly1.cif.gz_A | crystal structure of an 8 repeat consensus tpr superhelix | 0.9544 | 80 | 144 |
| 4mal-assembly1.cif.gz_A | tpr3 of fimv from p. aeruginosa (pao1) | 0.9513 | 18 | 65 |
| 4mbq-assembly2.cif.gz_C | tpr3 of fimv from p. aeruginosa (pao1) | 0.9414 | 18 | 64 |
| 4mbq-assembly2.cif.gz_D | tpr3 of fimv from p. aeruginosa (pao1) | 0.9307 | 18 | 65 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7MZ97_315_380_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9657 | 84 | 144 | 1.25.40.10 |
| af_I1JZZ0_142_217_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9631 | 78 | 143 | 1.25.40.10 |
| af_A0A0G2K726_580_643_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9616 | 86 | 144 | 1.25.40.10 |
| 2avpA00 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9544 | 80 | 144 | 1.25.40.10 |
| af_A0A0R4IV14_222_289_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.953 | 83 | 142 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X4XTE7-F1-model_v4 | Tetratricopeptide repeat protein | 0.9733 | 79 | 169 |
|
| AF-A0A657AR11-F1-model_v4 | Tetratricopeptide repeat protein | 0.9595 | 79 | 169 |
|
| AF-X1BVF4-F1-model_v4 | Tetratricopeptide repeat protein | 0.9578 | 82 | 170 |
|
| AF-A0A533WPL9-F1-model_v4 | Uncharacterized protein | 0.955 | 75 | 169 |
|
| AF-A0A3M1MPC9-F1-model_v4 | Tetratricopeptide repeat protein | 0.9535 | 79 | 172 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar